Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus phage phi29 Single-stranded DNA-binding protein (5)

Product Specifications

Product Name Alternative

SSB; Gene product 5; gp5; Protein p5

Abbreviation

Recombinant Bacillus phage phi29 Single-stranded DNA-binding protein

Gene Name

5

UniProt

Q38504

Expression Region

1-124aa

Organism

Bacillus phage phi29 (Bacteriophage phi-29)

Target Sequence

MENTNIVKATFDTETLEGQIKIFNAQTGGGQSFKNLPDGTIIEANAIAQYKQVSDTYGDAKEETVTTIFAADGSLYSAISKTVAEAASDLIDLVTRHKLETFKVKVVQGTSSKGNVFFSLQLSL

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Single-stranded DNA binding protein required for the elongation during viral DNA replication by strand displacement. Displaced viral DNA strands are transiently coated with the ssDNA-binding protein and therefore protected against nucleases. The latter is then probably removed by the replisome that performs lagging strand synthesis or during the events that lead up to the recombination process. Stimulates in vitro DNA replication several fold. Has helix-destabilizing activity since it removes secondary structure from the ssDNA in replicative intermediates.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELA2A Protein Lysate (Human) with C-Ha Tag
19188031 100 µg

ELA2A Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Recombinant Shigella Flexneri artQ Protein (aa 1-238)
VAng-Lsx07622-inquire Inquire

Recombinant Shigella Flexneri artQ Protein (aa 1-238)

Sign In for Pricing
View Details
FUT10 (NM_032664) Human Tagged ORF Clone
RG221222 10 µg

FUT10 (NM_032664) Human Tagged ORF Clone

Sign In for Pricing
View Details
TK1 (Thymidine Kinase 1, Soluble, TK2) (MaxLight 550)
MBS6219686-01 0.1 mL

TK1 (Thymidine Kinase 1, Soluble, TK2) (MaxLight 550)

Sign In for Pricing
View Details
TK1 (Thymidine Kinase 1, Soluble, TK2) (MaxLight 550)
MBS6219686-02 5x 0.1 mL

TK1 (Thymidine Kinase 1, Soluble, TK2) (MaxLight 550)

Sign In for Pricing
View Details
SPRR2D discontinued
514532 100 µg

SPRR2D discontinued

Sign In for Pricing
View Details