Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-4, Human (136a.a)

The FGF-4 protein coordinates embryonic development, cell proliferation and differentiation and is critical for normal limb and heart valve development. FGF-4 may promote embryonic molar tooth bud development by inducing key gene expression. FGF-4 Protein, Human (136a.a) is the recombinant human-derived FGF-4 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FGF-4 Protein, Human (136a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-4-protein-human-136a-a.html

Purity

97.00

Smiles

SGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

Molecular Formula

2249 (Gene_ID) P08620-1 (S71-L206) (Accession)

Molecular Weight

Approximately 14-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methyl Red Indicator AR
01743 00025 25 g

Methyl Red Indicator AR

Sign In for Pricing
View Details
rno-miR-3580-3p miRNA Antagomir
MBS8321072-01 10 nmol

rno-miR-3580-3p miRNA Antagomir

Sign In for Pricing
View Details
rno-miR-3580-3p miRNA Antagomir
MBS8321072-02 20 nmol

rno-miR-3580-3p miRNA Antagomir

Sign In for Pricing
View Details
rno-miR-3580-3p miRNA Antagomir
MBS8321072-03 5x 20 nmol

rno-miR-3580-3p miRNA Antagomir

Sign In for Pricing
View Details
PRMT2 (13S8) Mouse Monoclonal antibody
E28PE1095 100 µL

PRMT2 (13S8) Mouse Monoclonal antibody

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Stanniocalcin 2 (STC2)
MBS2149328-01 0.1 mL

PE-Linked Monoclonal Antibody to Stanniocalcin 2 (STC2)

Sign In for Pricing
View Details