Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-4, Human (136a.a)

The FGF-4 protein coordinates embryonic development, cell proliferation and differentiation and is critical for normal limb and heart valve development. FGF-4 may promote embryonic molar tooth bud development by inducing key gene expression. FGF-4 Protein, Human (136a.a) is the recombinant human-derived FGF-4 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FGF-4 Protein, Human (136a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-4-protein-human-136a-a.html

Purity

97.00

Smiles

SGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

Molecular Formula

2249 (Gene_ID) P08620-1 (S71-L206) (Accession)

Molecular Weight

Approximately 14-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal DNTTIP1 Antibody (OTI1F4) [Alexa Fluor 647]
NBP2-72352AF647 0.1 mL

Mouse Monoclonal DNTTIP1 Antibody (OTI1F4) [Alexa Fluor 647]

Sign In for Pricing
View Details
KISS1 (Kisspeptin 1, Malignant Melanoma Metastasis Suppressor, HH13, KiSS-1) discontinued
211652-01 20 µL

KISS1 (Kisspeptin 1, Malignant Melanoma Metastasis Suppressor, HH13, KiSS-1) discontinued

Sign In for Pricing
View Details
KISS1 (Kisspeptin 1, Malignant Melanoma Metastasis Suppressor, HH13, KiSS-1) discontinued
211652-02 100 µL

KISS1 (Kisspeptin 1, Malignant Melanoma Metastasis Suppressor, HH13, KiSS-1) discontinued

Sign In for Pricing
View Details
SCRN1 Protein Lysate (Rat) with C-HA Tag
43202036 100 µg

SCRN1 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Anti-DR5 [TRA-8], Mouse IgG1, Kappa
MBS488512-01 0.2 mg

Anti-DR5 [TRA-8], Mouse IgG1, Kappa

Sign In for Pricing
View Details
Anti-DR5 [TRA-8], Mouse IgG1, Kappa
MBS488512-02 5x 0.2 mg

Anti-DR5 [TRA-8], Mouse IgG1, Kappa

Sign In for Pricing
View Details