Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-4, Human (136a.a)

The FGF-4 protein coordinates embryonic development, cell proliferation and differentiation and is critical for normal limb and heart valve development. FGF-4 may promote embryonic molar tooth bud development by inducing key gene expression. FGF-4 Protein, Human (136a.a) is the recombinant human-derived FGF-4 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FGF-4 Protein, Human (136a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-4-protein-human-136a-a.html

Purity

97.00

Smiles

SGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

Molecular Formula

2249 (Gene_ID) P08620-1 (S71-L206) (Accession)

Molecular Weight

Approximately 14-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat NGF/Beta-NGF Polyclonal Antibody
E55A02199 100 µg

Rat NGF/Beta-NGF Polyclonal Antibody

Sign In for Pricing
View Details
Human Galactowaldenase Protein (Met 1-Ala 348) [His]
VAng-1666Lsx-1mg 1 mg

Human Galactowaldenase Protein (Met 1-Ala 348) [His]

Sign In for Pricing
View Details
DMEM (High glucose) (without L-glutamine)
PM150213B 500 mL

DMEM (High glucose) (without L-glutamine)

Sign In for Pricing
View Details
VAT1 Rabbit Polyclonal Antibody
TA359556 100 µL

VAT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NF-kB p65 (RELA) Rabbit Polyclonal Antibody
AP20704PU-N 100 µg

NF-kB p65 (RELA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Nidogen 1 Antibody
CPA5079-01 30 µL

Anti-Nidogen 1 Antibody

Sign In for Pricing
View Details