Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-4, Human (136a.a)

The FGF-4 protein coordinates embryonic development, cell proliferation and differentiation and is critical for normal limb and heart valve development. FGF-4 may promote embryonic molar tooth bud development by inducing key gene expression. FGF-4 Protein, Human (136a.a) is the recombinant human-derived FGF-4 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FGF-4 Protein, Human (136a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-4-protein-human-136a-a.html

Purity

97.00

Smiles

SGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

Molecular Formula

2249 (Gene_ID) P08620-1 (S71-L206) (Accession)

Molecular Weight

Approximately 14-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ZNF324 Protein - (Dry Ice)
H00025799-P01-25ug 25 µg

Recombinant Human ZNF324 Protein - (Dry Ice)

Sign In for Pricing
View Details
Rabbit Polyclonal ACE-2 Antibody [DyLight 650]
NBP1-76614C 0.1 mL

Rabbit Polyclonal ACE-2 Antibody [DyLight 650]

Sign In for Pricing
View Details
DPPA2 (Developmental Pluripotency-associated Protein 2, Pluripotent Embryonic Stem Cell-related Gene 1 Protein, PESCRG1) (Biotin) discontinued
030921-Biotin 200 µL

DPPA2 (Developmental Pluripotency-associated Protein 2, Pluripotent Embryonic Stem Cell-related Gene 1 Protein, PESCRG1) (Biotin) discontinued

Sign In for Pricing
View Details
ATP5F1D Antibody, HRP conjugated
A18732-50UG 50 µg

ATP5F1D Antibody, HRP conjugated

Sign In for Pricing
View Details
Recombinant Bovine Gap junction beta-2 protein (GJB2), partial
MBS7054931 Inquire

Recombinant Bovine Gap junction beta-2 protein (GJB2), partial

Sign In for Pricing
View Details
Persist Acetone Gel
25679-100 100 mL

Persist Acetone Gel

Sign In for Pricing
View Details