Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-4, Human (136a.a)

The FGF-4 protein coordinates embryonic development, cell proliferation and differentiation and is critical for normal limb and heart valve development. FGF-4 may promote embryonic molar tooth bud development by inducing key gene expression. FGF-4 Protein, Human (136a.a) is the recombinant human-derived FGF-4 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FGF-4 Protein, Human (136a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-4-protein-human-136a-a.html

Purity

97.00

Smiles

SGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

Molecular Formula

2249 (Gene_ID) P08620-1 (S71-L206) (Accession)

Molecular Weight

Approximately 14-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FoxO1/FKHR MAb (Clone 597554)
MAB5939-SP 25 µg

Human FoxO1/FKHR MAb (Clone 597554)

Sign In for Pricing
View Details
Rabbit Polyclonal PDCL Antibody
NBP2-81862 0.1 mg

Rabbit Polyclonal PDCL Antibody

Sign In for Pricing
View Details
PMFBP1 CRISPR Activation Plasmid (h)
sc-413470-ACT 20 µg

PMFBP1 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Trim28 sgRNA CRISPR Lentivector set (Rat)
K7097201 3x 1.0 µg

Trim28 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Recombinant Rickettsia felis NADH-quinone oxidoreductase subunit K (nuoK)
MBS7024170-01 0.02 mg

Recombinant Rickettsia felis NADH-quinone oxidoreductase subunit K (nuoK)

Sign In for Pricing
View Details
Recombinant Rickettsia felis NADH-quinone oxidoreductase subunit K (nuoK)
MBS7024170-02 0.1 mg

Recombinant Rickettsia felis NADH-quinone oxidoreductase subunit K (nuoK)

Sign In for Pricing
View Details