Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-4, Human (136a.a)

The FGF-4 protein coordinates embryonic development, cell proliferation and differentiation and is critical for normal limb and heart valve development. FGF-4 may promote embryonic molar tooth bud development by inducing key gene expression. FGF-4 Protein, Human (136a.a) is the recombinant human-derived FGF-4 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FGF-4 Protein, Human (136a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-4-protein-human-136a-a.html

Purity

97.00

Smiles

SGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

Molecular Formula

2249 (Gene_ID) P08620-1 (S71-L206) (Accession)

Molecular Weight

Approximately 14-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

REG4 Protein Lysate (Mouse) with C-HA Tag
38800034 100 µg

REG4 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
GIT1, phosphorylated (Tyr554) (ARF GTPase-activating protein GIT1, G protein-coupled receptor kinase-interactor 1, GRK-interacting protein 1, Cool-associated and tyrosine-phosphorylated protein 1, Cat-1, GIT1) (MaxLight 550) discontinued
G2035-07P-ML550 100 µL

GIT1, phosphorylated (Tyr554) (ARF GTPase-activating protein GIT1, G protein-coupled receptor kinase-interactor 1, GRK-interacting protein 1, Cool-associated and tyrosine-phosphorylated protein 1, Cat-1, GIT1) (MaxLight 550) discontinued

Sign In for Pricing
View Details
RGD1564712 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6025602 1.0 µg DNA

RGD1564712 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
CDK2 Rabbit Monoclonal Antibody
AMRe21498-01 50 µL

CDK2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CDK2 Rabbit Monoclonal Antibody
AMRe21498-02 100 µL

CDK2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CDK2 Rabbit Monoclonal Antibody
AMRe21498-03 200 µL

CDK2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details