Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-4, Human (136a.a)

The FGF-4 protein coordinates embryonic development, cell proliferation and differentiation and is critical for normal limb and heart valve development. FGF-4 may promote embryonic molar tooth bud development by inducing key gene expression. FGF-4 Protein, Human (136a.a) is the recombinant human-derived FGF-4 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FGF-4 Protein, Human (136a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-4-protein-human-136a-a.html

Purity

97.00

Smiles

SGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

Molecular Formula

2249 (Gene_ID) P08620-1 (S71-L206) (Accession)

Molecular Weight

Approximately 14-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-DEFA6 Polyclonal Antibody
RD77868A-01 20μL

Rabbit anti-DEFA6 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-DEFA6 Polyclonal Antibody
RD77868A-02 60μL

Rabbit anti-DEFA6 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-DEFA6 Polyclonal Antibody
RD77868A-03 120μL

Rabbit anti-DEFA6 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-DEFA6 Polyclonal Antibody
RD77868A-04 200μL

Rabbit anti-DEFA6 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse IL-3 Recombinant Rabbit monoclonal Antibody
HA723685B 100 µL

Mouse IL-3 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Rbmx sgRNA CRISPR Lentivector (Rat) (Target 3)
K7169304 1.0 µg DNA

Rbmx sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details