Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-4, Human (136a.a)

The FGF-4 protein coordinates embryonic development, cell proliferation and differentiation and is critical for normal limb and heart valve development. FGF-4 may promote embryonic molar tooth bud development by inducing key gene expression. FGF-4 Protein, Human (136a.a) is the recombinant human-derived FGF-4 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FGF-4 Protein, Human (136a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-4-protein-human-136a-a.html

Purity

97.00

Smiles

SGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

Molecular Formula

2249 (Gene_ID) P08620-1 (S71-L206) (Accession)

Molecular Weight

Approximately 14-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-(2-Carboxyphenyl)-7-diethylamino-2-(7-diethylamino-2-oxochroman-3-yl)-chromylium perchlorate
TRC-C181468-1G 1 g

4-(2-Carboxyphenyl)-7-diethylamino-2-(7-diethylamino-2-oxochroman-3-yl)-chromylium perchlorate

Sign In for Pricing
View Details
ALDH1L1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0070908 1.0 µg DNA

ALDH1L1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Glycated Hemoglobin A1c (HbA1c) Polyclonal Antibody
CAU35424-01 100 µL

Glycated Hemoglobin A1c (HbA1c) Polyclonal Antibody

Sign In for Pricing
View Details
Glycated Hemoglobin A1c (HbA1c) Polyclonal Antibody
CAU35424-02 200 µL

Glycated Hemoglobin A1c (HbA1c) Polyclonal Antibody

Sign In for Pricing
View Details
Glycated Hemoglobin A1c (HbA1c) Polyclonal Antibody
CAU35424-03 1 mL

Glycated Hemoglobin A1c (HbA1c) Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human SLFNL1 sgRNA gene knockout kit - Lentiviral human SLFNL1 sgRNA gene knockout kit (plasmid)
GTR15395132 1 Vial

Lentiviral human SLFNL1 sgRNA gene knockout kit - Lentiviral human SLFNL1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details