Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-4, Human (136a.a)

The FGF-4 protein coordinates embryonic development, cell proliferation and differentiation and is critical for normal limb and heart valve development. FGF-4 may promote embryonic molar tooth bud development by inducing key gene expression. FGF-4 Protein, Human (136a.a) is the recombinant human-derived FGF-4 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FGF-4 Protein, Human (136a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-4-protein-human-136a-a.html

Purity

97.00

Smiles

SGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

Molecular Formula

2249 (Gene_ID) P08620-1 (S71-L206) (Accession)

Molecular Weight

Approximately 14-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNORD116-21 CRISPR Knock Out 293T Cell Line (Human)
44792141 1x 10^6 Cells / 1.0 mL

SNORD116-21 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Recombinant Clostridium Tetani rpsB Protein (aa 1-233)
VAng-Lsx01779-1mgEcoli 1 mg (E. coli)

Recombinant Clostridium Tetani rpsB Protein (aa 1-233)

Sign In for Pricing
View Details
Monoclonal Neurofilament (NF-L) (Neuronal Marker) Antibody - With BSA and Azide, Clone: NFL/736
APR11333G 0.05mg

Monoclonal Neurofilament (NF-L) (Neuronal Marker) Antibody - With BSA and Azide, Clone: NFL/736

Sign In for Pricing
View Details
TAF1 Peptide - middle region
MBS3225994-01 0.1 mg

TAF1 Peptide - middle region

Sign In for Pricing
View Details
TAF1 Peptide - middle region
MBS3225994-02 5x 0.1 mg

TAF1 Peptide - middle region

Sign In for Pricing
View Details
DNAJB4 Polyclonal Antibody
RD75779A-01 20 µL

DNAJB4 Polyclonal Antibody

Sign In for Pricing
View Details