Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-4, Human (136a.a)

The FGF-4 protein coordinates embryonic development, cell proliferation and differentiation and is critical for normal limb and heart valve development. FGF-4 may promote embryonic molar tooth bud development by inducing key gene expression. FGF-4 Protein, Human (136a.a) is the recombinant human-derived FGF-4 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FGF-4 Protein, Human (136a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-4-protein-human-136a-a.html

Purity

97.00

Smiles

SGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

Molecular Formula

2249 (Gene_ID) P08620-1 (S71-L206) (Accession)

Molecular Weight

Approximately 14-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RHPN2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
39569111 3x 1.0 µg

RHPN2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Mouse Monoclonal HLA DRB1 Antibody (TDR 31.1) [mFluor Violet 450 SE]
NBP2-50421MFV450 0.1 mL

Mouse Monoclonal HLA DRB1 Antibody (TDR 31.1) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Trmt61a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7282708 1.0 µg DNA

Trmt61a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
PACCase (Phosphorylated Acetyl-CoA Carboxylase) Rat ELISA Kit
F6555 96 Tests

PACCase (Phosphorylated Acetyl-CoA Carboxylase) Rat ELISA Kit

Sign In for Pricing
View Details
12-Deoxyphorbol 13-palmitate
TBZ0253 unit

12-Deoxyphorbol 13-palmitate

Sign In for Pricing
View Details
Dispensing Bottle w/sealer cap, 30ml (48/CS)
43320060-1 1 CS

Dispensing Bottle w/sealer cap, 30ml (48/CS)

Sign In for Pricing
View Details