Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-4, Human (136a.a)

The FGF-4 protein coordinates embryonic development, cell proliferation and differentiation and is critical for normal limb and heart valve development. FGF-4 may promote embryonic molar tooth bud development by inducing key gene expression. FGF-4 Protein, Human (136a.a) is the recombinant human-derived FGF-4 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FGF-4 Protein, Human (136a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-4-protein-human-136a-a.html

Purity

97.00

Smiles

SGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

Molecular Formula

2249 (Gene_ID) P08620-1 (S71-L206) (Accession)

Molecular Weight

Approximately 14-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Campylobacter Jejuni rplX Protein (aa 1-77) (strain RM1221)
VAng-Ly2895-50gEcoli 50 µg (E. coli)

Recombinant Campylobacter Jejuni rplX Protein (aa 1-77) (strain RM1221)

Sign In for Pricing
View Details
Phospho-JunD (Ser255) Polyclonal Antibody, PE-Cy7 Conjugated
bs-5466R-PE-Cy7 100 µL

Phospho-JunD (Ser255) Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
EZEE Pipette - Volume; 0.5 - 10ul
EZEEPETTE-10 0.5 - 10 µL

EZEE Pipette - Volume; 0.5 - 10ul

Sign In for Pricing
View Details
Silver Nitrate 0.171N (0.171M)
40120432-1 500 ml

Silver Nitrate 0.171N (0.171M)

Sign In for Pricing
View Details
NPY1R (NPYR, NPYY1, Neuropeptide Y Receptor Type 1) (MaxLight 405) discontinued
130517-ML405 100 µL

NPY1R (NPYR, NPYY1, Neuropeptide Y Receptor Type 1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
1,2:3,4-Di-O-isopropylidene-6-O-mesyl-α-D-galactopyranose
GC1750-10g 10 g

1,2:3,4-Di-O-isopropylidene-6-O-mesyl-α-D-galactopyranose

Sign In for Pricing
View Details