Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-4, Human (136a.a)

The FGF-4 protein coordinates embryonic development, cell proliferation and differentiation and is critical for normal limb and heart valve development. FGF-4 may promote embryonic molar tooth bud development by inducing key gene expression. FGF-4 Protein, Human (136a.a) is the recombinant human-derived FGF-4 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FGF-4 Protein, Human (136a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-4-protein-human-136a-a.html

Purity

97.00

Smiles

SGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

Molecular Formula

2249 (Gene_ID) P08620-1 (S71-L206) (Accession)

Molecular Weight

Approximately 14-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF3S2 (EIF3I) Human Gene Knockout Kit (CRISPR)
KN401833 1 Kit

EIF3S2 (EIF3I) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Lentiviral human PPP1CB shRNA (UAS) - Lentiviral human PPP1CB shRNA (UAS) (100)
GTR15153162 1 Vial

Lentiviral human PPP1CB shRNA (UAS) - Lentiviral human PPP1CB shRNA (UAS) (100)

Sign In for Pricing
View Details
Rabbit Polyclonal BHLHB5 Antibody
NBP2-39016-25ul 25 µL

Rabbit Polyclonal BHLHB5 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal HPd2 Antibody (DHIC2-5H10)
NBP1-18955SS 0.025 mL

Mouse Monoclonal HPd2 Antibody (DHIC2-5H10)

Sign In for Pricing
View Details
Cadherin-13 (CDH13) Antibody (Biotin)
abx271497-01 200 µL

Cadherin-13 (CDH13) Antibody (Biotin)

Sign In for Pricing
View Details
Cadherin-13 (CDH13) Antibody (Biotin)
abx271497-02 1 mL

Cadherin-13 (CDH13) Antibody (Biotin)

Sign In for Pricing
View Details