Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-4, Human (136a.a)

The FGF-4 protein coordinates embryonic development, cell proliferation and differentiation and is critical for normal limb and heart valve development. FGF-4 may promote embryonic molar tooth bud development by inducing key gene expression. FGF-4 Protein, Human (136a.a) is the recombinant human-derived FGF-4 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FGF-4 Protein, Human (136a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-4-protein-human-136a-a.html

Purity

97.00

Smiles

SGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

Molecular Formula

2249 (Gene_ID) P08620-1 (S71-L206) (Accession)

Molecular Weight

Approximately 14-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Hbq1a shRNA (UAS) - Lentiviral mouse Hbq1a shRNA (UAS, iRFP) (100)
GTR15254307 1 Vial

Lentiviral mouse Hbq1a shRNA (UAS) - Lentiviral mouse Hbq1a shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Mouse Monoclonal ACAT2 Antibody (OTI3E2) [Alexa Fluor 532]
NBP2-70068AF532 0.1 mL

Mouse Monoclonal ACAT2 Antibody (OTI3E2) [Alexa Fluor 532]

Sign In for Pricing
View Details
Rabbit Anti-Bovine Aromatic-L-Amino-Acid Decarboxylase (DDC) Polyclonal Antibody
VD11N689 1 Each

Rabbit Anti-Bovine Aromatic-L-Amino-Acid Decarboxylase (DDC) Polyclonal Antibody

Sign In for Pricing
View Details
Early placenta Insulin-Like Peptide (INSL4) Human ELISA Kit
D0940 96 Tests

Early placenta Insulin-Like Peptide (INSL4) Human ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal LXR alpha/NR1H3 Antibody
NBP1-92086-25ul 25 µL

Rabbit Polyclonal LXR alpha/NR1H3 Antibody

Sign In for Pricing
View Details
ACOXL (NM_001142807) Human Tagged ORF Clone Lentiviral Particle
RC227109L3V 200 µL

ACOXL (NM_001142807) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details