Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-4, Human (136a.a)

The FGF-4 protein coordinates embryonic development, cell proliferation and differentiation and is critical for normal limb and heart valve development. FGF-4 may promote embryonic molar tooth bud development by inducing key gene expression. FGF-4 Protein, Human (136a.a) is the recombinant human-derived FGF-4 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FGF-4 Protein, Human (136a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-4-protein-human-136a-a.html

Purity

97.00

Smiles

SGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

Molecular Formula

2249 (Gene_ID) P08620-1 (S71-L206) (Accession)

Molecular Weight

Approximately 14-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

(3S,5S) -3,5-Bis (tert-butyldimethylsilyloxy) -2-methyl-1-cyclohexen-1-ol 1-Trifluoromethanesulfonate
004084 2.5 mg

(3S,5S) -3,5-Bis (tert-butyldimethylsilyloxy) -2-methyl-1-cyclohexen-1-ol 1-Trifluoromethanesulfonate

Sign In for Pricing
View Details
Glutathione S-Transferase (GST) (MaxLight 550) discontinued
G8135-08-ML550 100 µL

Glutathione S-Transferase (GST) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Ccdc68 (NM_001077667) Rat Untagged Clone
RN210561 10 µg

Ccdc68 (NM_001077667) Rat Untagged Clone

Sign In for Pricing
View Details
Flk-1/VEGFR2 Polyclonal Antibody
UB-GEN-13039 100 µL

Flk-1/VEGFR2 Polyclonal Antibody

Sign In for Pricing
View Details
ARMC6 Protein Vector (Mouse) (pPM-C-HA)
PV156244 500 ng

ARMC6 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
anti-ATAD3B
YF-PA21274 50 ug

anti-ATAD3B

Sign In for Pricing
View Details