FGF-4, Human (136a.a)
The FGF-4 protein coordinates embryonic development, cell proliferation and differentiation and is critical for normal limb and heart valve development. FGF-4 may promote embryonic molar tooth bud development by inducing key gene expression. FGF-4 Protein, Human (136a.a) is the recombinant human-derived FGF-4 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
FGF-4 Protein, Human (136a.a), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/fgf-4-protein-human-136a-a.html
Purity
97.00
Smiles
SGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL
Molecular Formula
2249 (Gene_ID) P08620-1 (S71-L206) (Accession)
Molecular Weight
Approximately 14-17 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Mouse Chemokine-Like Protein TAFA-4 (TAFA4) ELISA Kit
Mouse Chemokine-Like Protein TAFA-4 (TAFA4) ELISA Kit
Mouse Chemokine-Like Protein TAFA-4 (TAFA4) ELISA Kit
ND3, NT (MT-ND3, MTND3, NADH3, ND3, NADH-ubiquinone oxidoreductase chain 3, NADH dehydrogenase subunit 3) (MaxLight 750) discontinued
DAPP1 (Dual Adapter for Phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide, hDAPP1, B Lymphocyte Adapter Protein Bam32, B Cell Adapter Molecule of 32kD, BAM32, HSPC066, DKFZp667E0716) (MaxLight 750)