Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-4, Human (136a.a)

The FGF-4 protein coordinates embryonic development, cell proliferation and differentiation and is critical for normal limb and heart valve development. FGF-4 may promote embryonic molar tooth bud development by inducing key gene expression. FGF-4 Protein, Human (136a.a) is the recombinant human-derived FGF-4 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FGF-4 Protein, Human (136a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-4-protein-human-136a-a.html

Purity

97.00

Smiles

SGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

Molecular Formula

2249 (Gene_ID) P08620-1 (S71-L206) (Accession)

Molecular Weight

Approximately 14-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal FAM73A Antibody
NBP1-93832 0.1 mL

Rabbit Polyclonal FAM73A Antibody

Sign In for Pricing
View Details
Lentiviral human ANGPTL8 shRNA (UAS) - Lentiviral human ANGPTL8 shRNA (UAS, GFP) (25)
GTR15097424 1 Vial

Lentiviral human ANGPTL8 shRNA (UAS) - Lentiviral human ANGPTL8 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
SHP1 (Ser-591), phospho-specific
MBS472061-01 0.1 mL

SHP1 (Ser-591), phospho-specific

Sign In for Pricing
View Details
SHP1 (Ser-591), phospho-specific
MBS472061-02 5x 0.1 mL

SHP1 (Ser-591), phospho-specific

Sign In for Pricing
View Details
Natural cytotoxicity triggering Receptor 1 (NCR1) Mouse ELISA Kit
F2851 96 Tests

Natural cytotoxicity triggering Receptor 1 (NCR1) Mouse ELISA Kit

Sign In for Pricing
View Details
MSK-195
sc-202712A 5 mg

MSK-195

Sign In for Pricing
View Details