FGF-4, Human (136a.a)
The FGF-4 protein coordinates embryonic development, cell proliferation and differentiation and is critical for normal limb and heart valve development. FGF-4 may promote embryonic molar tooth bud development by inducing key gene expression. FGF-4 Protein, Human (136a.a) is the recombinant human-derived FGF-4 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
FGF-4 Protein, Human (136a.a), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/fgf-4-protein-human-136a-a.html
Purity
97.00
Smiles
SGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL
Molecular Formula
2249 (Gene_ID) P08620-1 (S71-L206) (Accession)
Molecular Weight
Approximately 14-17 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Lentiviral mouse Dguok shRNA (UAS) - Lentiviral mouse Dguok shRNA (UAS, iRFP) plasmid
NELL2 (Protein Kinase C-binding Protein NELL2, MEL91 Protein, NEL-like Protein 2, Mel91) (MaxLight 490)
NELL2 (Protein Kinase C-binding Protein NELL2, MEL91 Protein, NEL-like Protein 2, Mel91) (MaxLight 490)
Lentiviral mouse Cox15 shRNA (UAS) - Lentiviral mouse Cox15 shRNA (UAS, RFP) (100)