FGF-4, Human (136a.a)
The FGF-4 protein coordinates embryonic development, cell proliferation and differentiation and is critical for normal limb and heart valve development. FGF-4 may promote embryonic molar tooth bud development by inducing key gene expression. FGF-4 Protein, Human (136a.a) is the recombinant human-derived FGF-4 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
FGF-4 Protein, Human (136a.a), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/fgf-4-protein-human-136a-a.html
Purity
97.00
Smiles
SGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL
Molecular Formula
2249 (Gene_ID) P08620-1 (S71-L206) (Accession)
Molecular Weight
Approximately 14-17 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
![Rabbit Polyclonal SUV420h1 Antibody [DyLight 594]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
Rabbit Polyclonal SUV420h1 Antibody [DyLight 594]
Recombinant Lymantria dispar multicapsid nuclear polyhedrosis virus Major capsid protein (P39)
Recombinant Lymantria dispar multicapsid nuclear polyhedrosis virus Major capsid protein (P39)
Recombinant Lymantria dispar multicapsid nuclear polyhedrosis virus Major capsid protein (P39)