Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-4, Human (136a.a)

The FGF-4 protein coordinates embryonic development, cell proliferation and differentiation and is critical for normal limb and heart valve development. FGF-4 may promote embryonic molar tooth bud development by inducing key gene expression. FGF-4 Protein, Human (136a.a) is the recombinant human-derived FGF-4 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FGF-4 Protein, Human (136a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-4-protein-human-136a-a.html

Purity

97.00

Smiles

SGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

Molecular Formula

2249 (Gene_ID) P08620-1 (S71-L206) (Accession)

Molecular Weight

Approximately 14-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal CCR5 [p Ser337] Antibody (V14/2) [Janelia Fluor 549]
NBP3-11996JF549 0.1 mL

Rabbit Monoclonal CCR5 [p Ser337] Antibody (V14/2) [Janelia Fluor 549]

Sign In for Pricing
View Details
Stat5a Polyclonal Antibody
MBS8525433-01 0.1 mg

Stat5a Polyclonal Antibody

Sign In for Pricing
View Details
Stat5a Polyclonal Antibody
MBS8525433-02 0.1 mL (AF635)

Stat5a Polyclonal Antibody

Sign In for Pricing
View Details
Stat5a Polyclonal Antibody
MBS8525433-03 0.1 mL (AF610)

Stat5a Polyclonal Antibody

Sign In for Pricing
View Details
Stat5a Polyclonal Antibody
MBS8525433-04 0.1 mL (AF405S)

Stat5a Polyclonal Antibody

Sign In for Pricing
View Details
Stat5a Polyclonal Antibody
MBS8525433-05 0.1 mL (AF405L)

Stat5a Polyclonal Antibody

Sign In for Pricing
View Details