Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-4, Human (136a.a)

The FGF-4 protein coordinates embryonic development, cell proliferation and differentiation and is critical for normal limb and heart valve development. FGF-4 may promote embryonic molar tooth bud development by inducing key gene expression. FGF-4 Protein, Human (136a.a) is the recombinant human-derived FGF-4 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FGF-4 Protein, Human (136a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-4-protein-human-136a-a.html

Purity

97.00

Smiles

SGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

Molecular Formula

2249 (Gene_ID) P08620-1 (S71-L206) (Accession)

Molecular Weight

Approximately 14-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSBP3 (NM_145716) Human Tagged Lenti ORF Clone
RC209426L4 10 µg

SSBP3 (NM_145716) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Dnajc12 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3488803 1.0 µg DNA

Dnajc12 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Rabbit Polyclonal MYBBP1A Antibody
H00010514-D01P 0.1 mg

Rabbit Polyclonal MYBBP1A Antibody

Sign In for Pricing
View Details
ODF3L1 (NM_175881) Human Over-expression Lysate
LC406197 20 µg

ODF3L1 (NM_175881) Human Over-expression Lysate

Sign In for Pricing
View Details
Human C-Type Lectin Domain Family 4, Member K (CLEC4K) ELISA Kit
MBS458418-01 48 Tests

Human C-Type Lectin Domain Family 4, Member K (CLEC4K) ELISA Kit

Sign In for Pricing
View Details
Human C-Type Lectin Domain Family 4, Member K (CLEC4K) ELISA Kit
MBS458418-02 96 Tests

Human C-Type Lectin Domain Family 4, Member K (CLEC4K) ELISA Kit

Sign In for Pricing
View Details