Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-4, Human (136a.a)

The FGF-4 protein coordinates embryonic development, cell proliferation and differentiation and is critical for normal limb and heart valve development. FGF-4 may promote embryonic molar tooth bud development by inducing key gene expression. FGF-4 Protein, Human (136a.a) is the recombinant human-derived FGF-4 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FGF-4 Protein, Human (136a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-4-protein-human-136a-a.html

Purity

97.00

Smiles

SGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

Molecular Formula

2249 (Gene_ID) P08620-1 (S71-L206) (Accession)

Molecular Weight

Approximately 14-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nup35 (NM_001190179) Mouse Tagged ORF Clone
MR204732 10 µg

Nup35 (NM_001190179) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ADCK5 siRNA (Human)
MBS8201303-01 15 nmol

ADCK5 siRNA (Human)

Sign In for Pricing
View Details
ADCK5 siRNA (Human)
MBS8201303-02 30 nmol

ADCK5 siRNA (Human)

Sign In for Pricing
View Details
ADCK5 siRNA (Human)
MBS8201303-03 5x 30 nmol

ADCK5 siRNA (Human)

Sign In for Pricing
View Details
PHD finger protein 10 (PHF10) Human ELISA Kit
F8145 96 Tests

PHD finger protein 10 (PHF10) Human ELISA Kit

Sign In for Pricing
View Details
SLC35B4 Antibody, Biotin conjugated
A65331-100UG 100 µg

SLC35B4 Antibody, Biotin conjugated

Sign In for Pricing
View Details