Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PD-L1, Rat (HEK293, His)

PD-L1 (Programmed death-ligand 1) critically regulates T cell proliferation and migration, acting as a biomarker for periodontitis and pre-eclampsia. CD274 is its human ortholog. Biased expression in the thymus (RPKM 102.9), spleen (RPKM 58.3), and other tissues emphasizes PD-L1's centrality in immune regulation across diverse physiological and pathological conditions. PD-L1 Protein, Rat (HEK293, His) is the recombinant rat-derived PD-L1 protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

PD-L1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pd-l1-protein-rat-hek293-his.html

Purity

98.0

Smiles

AFTITAPKDLYVVEYGSNVTMECRFPVEQKLDLLALVVYWEKEDKEVIQFVEGEEDLKPQHSSFRGRAFLPKDQLLKGNAVLQITDVKLQDAGVYCCMISYGGADYKRITLKVNAPYRKINQRISMDPATSEHELMCQAEGYPEAEVIWTNSDHQSLSGETTVTTSQTEEKLLNVTSVLRVNATANDVFHCTFWRVHSGENHTAELIIPELPVPRLPHNRT

Molecular Formula

499342 (Gene_ID) NP_001178883.1 (A18-T238) (Accession)

Molecular Weight

Approximately 41.79 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (158-2B3), CF488A conjugate, 0.1mg/mL
BNC880352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF405M conjugate, 0.1mg/mL
BNC051037-100 1x 100 µL

CD44 Standard (DF1485), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL
BNC470031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF568 conjugate, 0.1mg/mL
BNC680193-100 1x 100 µL

CD86 (BU63), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL
BNC401429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Lambda Light Chain (LcN-2), CF640R conjugate, 0.1mg/mL
BNC400631-100 1x 100 µL

Human Lambda Light Chain (LcN-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details