Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PD-L1, Rat (HEK293, His)

PD-L1 (Programmed death-ligand 1) critically regulates T cell proliferation and migration, acting as a biomarker for periodontitis and pre-eclampsia. CD274 is its human ortholog. Biased expression in the thymus (RPKM 102.9), spleen (RPKM 58.3), and other tissues emphasizes PD-L1's centrality in immune regulation across diverse physiological and pathological conditions. PD-L1 Protein, Rat (HEK293, His) is the recombinant rat-derived PD-L1 protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

PD-L1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pd-l1-protein-rat-hek293-his.html

Purity

98.0

Smiles

AFTITAPKDLYVVEYGSNVTMECRFPVEQKLDLLALVVYWEKEDKEVIQFVEGEEDLKPQHSSFRGRAFLPKDQLLKGNAVLQITDVKLQDAGVYCCMISYGGADYKRITLKVNAPYRKINQRISMDPATSEHELMCQAEGYPEAEVIWTNSDHQSLSGETTVTTSQTEEKLLNVTSVLRVNATANDVFHCTFWRVHSGENHTAELIIPELPVPRLPHNRT

Molecular Formula

499342 (Gene_ID) NP_001178883.1 (A18-T238) (Accession)

Molecular Weight

Approximately 41.79 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Mouse GATA-binding factor 2 (GATA 2) IgG (aff pure)
AB-23082-A 100 µg

Rabbit Anti-Mouse GATA-binding factor 2 (GATA 2) IgG (aff pure)

Sign In for Pricing
View Details
Slides Staining Jar, with Ground - in
CG147-5X1NO 1 unit

Slides Staining Jar, with Ground - in

Sign In for Pricing
View Details
Rbm39 AAV siRNA Pooled Vector
38631164 1.0 µg

Rbm39 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
HIV-1 tat, Strain IIIB (Human Immunodeficiency Virus-1) (HRP)
MBS600503-01 200 Tests

HIV-1 tat, Strain IIIB (Human Immunodeficiency Virus-1) (HRP)

Sign In for Pricing
View Details
HIV-1 tat, Strain IIIB (Human Immunodeficiency Virus-1) (HRP)
MBS600503-02 5x 200 Tests

HIV-1 tat, Strain IIIB (Human Immunodeficiency Virus-1) (HRP)

Sign In for Pricing
View Details
VDAC/Porin/VDAC1 Rabbit Polyclonal Antibody (Fluoro594)
orb3081832 100 µg

VDAC/Porin/VDAC1 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details