Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIM-3/HAVCR2, Cynomolgus (HEK293, His)

The TIM-3/HAVCR2 protein is a cell surface receptor that regulates immune responses by inhibiting macrophage activation and suppressing Th1-mediated autoimmunity. TIM-3/HAVCR2 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived TIM-3/HAVCR2 protein, expressed by HEK293 , with N-8*His labeled tag.

Product Specifications

Product Name Alternative

TIM-3/HAVCR2 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tim-3-havcr2-protein-cynomolgus-hek-293-his.html

Purity

96.77

Smiles

SEVEYIAEVGQNAYLPCSYTPAPPGNLVPVCWGKGACPVFDCSNVVLRTDNRDVNDRTSGRYWLKGDFHKGDVSLTIENVTLADSGVYCCRIQIPGIMNDEKHNVKLVVIKPAKVTPAPTLQRDLTSAFPRMLTTGEHGPAETQTPGSLPDVNLTVSNFFCELQIFTLTNELRDSGATIR

Molecular Formula

10214172 (Gene_ID) G7P6Q7 (S22-R201) (Accession)

Molecular Weight

26-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR18 3'UTR Luciferase Stable Cell Line
TU009147 1.0 mL

GPR18 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
CD4
E8ER1706-80 100 µL

CD4

Sign In for Pricing
View Details
Donkey Polyclonal Donkey anti-Human IgG (H+L) Secondary Antibody [DyLight 755]
NBP2-60666IR 0.5 mL

Donkey Polyclonal Donkey anti-Human IgG (H+L) Secondary Antibody [DyLight 755]

Sign In for Pricing
View Details
Rabbit Anti Human APPL1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,IHC,ELISA) 120UL
IRBAMLAPPL1AP72120UL 120 µL

Rabbit Anti Human APPL1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,IHC,ELISA) 120UL

Sign In for Pricing
View Details
Apolipoprotein E (APOE) Bovine ELISA Kit
B6236 96 Tests

Apolipoprotein E (APOE) Bovine ELISA Kit

Sign In for Pricing
View Details
[2- (benzyloxy) phenyl][3- (4-chlorophenyl) oxiran-2-yl]methanone
OR26392 1 Each

[2- (benzyloxy) phenyl][3- (4-chlorophenyl) oxiran-2-yl]methanone

Sign In for Pricing
View Details