Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SF20/MYDGF, Human (HEK293, His)

The MYDGF protein is derived from bone marrow mononuclear cells and significantly promotes cardioprotection and post-myocardial infarction (MI) repair. Its functions include promoting cardiomyocyte survival and promoting adaptive angiogenesis. SF20/MYDGF Protein, Human (HEK293, His) is the recombinant human-derived SF20/MYDGF protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

SF20/MYDGF Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sf20-mydgf-protein-human-hek293-his.html

Purity

97

Smiles

VSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQGGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAEIEYAMAYSKAAFERESDVPLKTEEFEVTKTAVAHRPGAFKAELSKLVIVAKASRTEL

Molecular Formula

56005 (Gene_ID) Q969H8 (V32-L173) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NF1 Antibody
43778 100 µL

NF1 Antibody

Sign In for Pricing
View Details
Rat Platelet Basic Protein / CXCL7 (PPBP) ELISA Kit
abx256117-01 96 Tests

Rat Platelet Basic Protein / CXCL7 (PPBP) ELISA Kit

Sign In for Pricing
View Details
Rat Platelet Basic Protein / CXCL7 (PPBP) ELISA Kit
abx256117-02 5x 96 Tests

Rat Platelet Basic Protein / CXCL7 (PPBP) ELISA Kit

Sign In for Pricing
View Details
Rat Platelet Basic Protein / CXCL7 (PPBP) ELISA Kit
abx256117-03 10x 96 Tests

Rat Platelet Basic Protein / CXCL7 (PPBP) ELISA Kit

Sign In for Pricing
View Details
Vmn2r98 (NM_001104550) Mouse Tagged ORF Clone
MG213596 10 µg

Vmn2r98 (NM_001104550) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
PAMCI/RASF9 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-21011R-PerCP-Cy5.5 100 µL

PAMCI/RASF9 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details