Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lipocalin-1 (LCN1)

Product Specifications

Product Name Alternative

Tear lipocalin; Tlc; Tear prealbumin; TP; von Ebner gland protein; VEG protein

Abbreviation

Recombinant Human LCN1 protein

Gene Name

LCN1

UniProt

P31025

Expression Region

19-176aa

Organism

Homo sapiens (Human)

Target Sequence

HHLLASDEEIQDVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARGLSTESILIPRQSETCSPGSD

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Could play a role in taste reception. Could be necessary for the concentration and delivery of sapid molecules in the gustatory system. Can bind various ligands, with chemical structures ranging from lipids and retinoids to the macrocyclic antibiotic rifampicin and even to microbial siderophores. Exhibits an extremely wide ligand pocket.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

24.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Oryza sativa subsp. indica Transcription factor PCF2 (PCF2)
MBS1056937-01 0.02 mg (E-Coli)

Recombinant Oryza sativa subsp. indica Transcription factor PCF2 (PCF2)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. indica Transcription factor PCF2 (PCF2)
MBS1056937-02 0.02 mg (Yeast)

Recombinant Oryza sativa subsp. indica Transcription factor PCF2 (PCF2)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. indica Transcription factor PCF2 (PCF2)
MBS1056937-03 0.1 mg (E-Coli)

Recombinant Oryza sativa subsp. indica Transcription factor PCF2 (PCF2)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. indica Transcription factor PCF2 (PCF2)
MBS1056937-04 0.1 mg (Yeast)

Recombinant Oryza sativa subsp. indica Transcription factor PCF2 (PCF2)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. indica Transcription factor PCF2 (PCF2)
MBS1056937-05 0.02 mg (Baculovirus)

Recombinant Oryza sativa subsp. indica Transcription factor PCF2 (PCF2)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. indica Transcription factor PCF2 (PCF2)
MBS1056937-06 0.02 mg (Mammalian-Cell)

Recombinant Oryza sativa subsp. indica Transcription factor PCF2 (PCF2)

Sign In for Pricing
View Details