Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Human (Biotinylated, HEK293, Avi-His)

IL-13 protein is a cytokine involved in allergic inflammation, immune response to parasites, and B cell proliferation. IL-13 Protein, Human (Biotinylated, HEK293, Avi-His) is the recombinant human-derived IL-13 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-13 Protein, Human (Biotinylated, HEK293, Avi-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-human-biotinylated-hek293-avi-his.html

Purity

95.00

Smiles

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Molecular Formula

3596 (Gene_ID) AAK53823.1 (G21-N132) (Accession)

Molecular Weight

Approximately 22-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Labetuzumab Biosimilar - Research Grade
ICH5617-10mg 10 mg

Labetuzumab Biosimilar - Research Grade

Sign In for Pricing
View Details
PRAMEF7 Protein Lysate (Human) with C-Ha Tag
37546031 100 µg

PRAMEF7 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
PRKAA2, Biotinylated Antibody
orb403009 100 µg

PRKAA2, Biotinylated Antibody

Sign In for Pricing
View Details
Neuropeptide S (Mouse) acetate
TP1981L-01 1 mg

Neuropeptide S (Mouse) acetate

Sign In for Pricing
View Details
Neuropeptide S (Mouse) acetate
TP1981L-02 5 mg

Neuropeptide S (Mouse) acetate

Sign In for Pricing
View Details
Neuropeptide S (Mouse) acetate
TP1981L-03 10 mg

Neuropeptide S (Mouse) acetate

Sign In for Pricing
View Details