Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCL4, Rat

CCL4 protein, a monokine, acts as a homodimer and displays inflammatory and chemokinetic properties. CCL4 Protein, Rat is the recombinant rat-derived CCL4 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

CCL4 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccl4-protein-rat.html

Purity

97.00

Smiles

APIGSDPPTSCCFSYTSRKIHRNFVMDYYETSSLCSQPAVVFLTKKGRQICADPSEPWVNEYVNDLELN

Molecular Formula

116637 (Gene_ID) P50230 (A24-N92) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

tert-Butyl 6-Hydroxyhexanoate
TRC-B691995-5G 5 g

tert-Butyl 6-Hydroxyhexanoate

Sign In for Pricing
View Details
TMEM70 (NM_001040613) Human Over-expression Lysate
LY421778 100 µg

TMEM70 (NM_001040613) Human Over-expression Lysate

Sign In for Pricing
View Details
Human MAPK1IP1L activation kit by CRISPRa
GA114286 1 Kit

Human MAPK1IP1L activation kit by CRISPRa

Sign In for Pricing
View Details
Sodium Potassium ATPase (ATP1A1) Rabbit Polyclonal Antibody
AP20203PU-N 100 µg

Sodium Potassium ATPase (ATP1A1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Alpha B Crystallin (CRYAB) Rabbit Polyclonal Antibody
TA384046 100 µL

Alpha B Crystallin (CRYAB) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MAPT / TAU Rabbit Polyclonal Antibody
AP02634PU-N 100 µL

MAPT / TAU Rabbit Polyclonal Antibody

Sign In for Pricing
View Details