Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCL4, Rat

CCL4 protein, a monokine, acts as a homodimer and displays inflammatory and chemokinetic properties. CCL4 Protein, Rat is the recombinant rat-derived CCL4 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

CCL4 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccl4-protein-rat.html

Purity

97.00

Smiles

APIGSDPPTSCCFSYTSRKIHRNFVMDYYETSSLCSQPAVVFLTKKGRQICADPSEPWVNEYVNDLELN

Molecular Formula

116637 (Gene_ID) P50230 (A24-N92) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNORD116-11 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2246806 1.0 µg DNA

SNORD116-11 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
MYOC (Myocilin, Trabecular Meshwork-Induced Glucocorticoid Response Protein, GLC1A, TIGR) (MaxLight 650)
130080-ML650 100 µL

MYOC (Myocilin, Trabecular Meshwork-Induced Glucocorticoid Response Protein, GLC1A, TIGR) (MaxLight 650)

Sign In for Pricing
View Details
MTFMT Antibody
orb1322761-01 30 µL

MTFMT Antibody

Sign In for Pricing
View Details
MTFMT Antibody
orb1322761-02 50 μL

MTFMT Antibody

Sign In for Pricing
View Details
MTFMT Antibody
orb1322761-03 100 µL

MTFMT Antibody

Sign In for Pricing
View Details
Rat monoclonal Laminin antibody
MBS5306603-01 0.1 mg

Rat monoclonal Laminin antibody

Sign In for Pricing
View Details