Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GALNT3, Human (HEK293, His)

GALNT3 Protein initiates O-linked oligosaccharide biosynthesis by transferring an N-acetyl-D-galactosamine residue to serine or threonine on protein receptors, including HIV envelope glycoproteins (gp120), EA2, MUC2, MUC1A, MUC5AC, and possibly fibronectin. GALNT3 also glycosylates FGF23 in vivo. GALNT3 Protein, Human (HEK293, His) is the recombinant human-derived GALNT3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

GALNT3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/galnt3-protein-human-hek-293-his.html

Purity

95.0

Smiles

QREVSVQYSKEESRMERNMKNKNKMLDLMLEAVNNIKDAMPKMQIGAPVRQNIDAGERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKAFKTTNLSVEEQKEKERGEAKHCFNAFASDRISLHRDLGPDTRPPECIEQKFKRCPPLPTTSVIIVFHNEAWSTLLRTVHSVLYSSPAILLKEIILVDDASVDEYLHDKLDEYVKQFSIVKIVRQRERKGLITARLLGATVATAETLTFLDAHCECFYGWLEPLLARIAENYTAVVSPDIASIDLNTFEFNKPSPYGSNHNRGNFDWSLSFGWESLPDHEKQRRKDETYPIKTPTFAGGLFSISKEYFEYIGSYDEEMEIWGGENIEMSFRVWQCGGQLEIMPCSVVGHVFRSKSPHSFPKGTQVIARNQVRLAEVWMDEYKEIFYRRNTDAAKIVKQKAFGDLSKRFEIKHRLQCKNFTWYLNNIYPEVYVPDLNPVISGYIKSVGQPLCLDVGENNQGGKPLIMYTCHGLGGNQYFEYSAQHEIRHNIQKELCLHAAQGLVQLKACTYKGHKTVVTGEQIWEIQKDQLLYNPFLKMCLSANGEHPSLVSCNPSDPLQKWILSQND

Molecular Formula

2591 (Gene_ID) Q14435-1 (Q38-D633) (Accession)

Molecular Weight

Approximately 80.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL
BNC880158-100 1x 100 µL

Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF568 conjugate, 0.1mg/mL
BNC680305-100 1x 100 µL

CD95 (B-R18), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rb1 (Tumor Suppressor Protein) (RB1/2313R), CF405S conjugate, 0.1mg/mL
BNC042313-500 1x 500 µL

Rb1 (Tumor Suppressor Protein) (RB1/2313R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (N-Terminal) (Pituitary Marker) (r57), CF740 conjugate, 0.1mg/mL
BNC741380-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (N-Terminal) (Pituitary Marker) (r57), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF488A conjugate, 0.1mg/mL
BNC882171-500 1x 500 µL

Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2616), CF647 conjugate, 0.1mg/mL
BNC472616-500 1x 500 µL

Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2616), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details