Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GALNT3, Human (HEK293, His)

GALNT3 Protein initiates O-linked oligosaccharide biosynthesis by transferring an N-acetyl-D-galactosamine residue to serine or threonine on protein receptors, including HIV envelope glycoproteins (gp120), EA2, MUC2, MUC1A, MUC5AC, and possibly fibronectin. GALNT3 also glycosylates FGF23 in vivo. GALNT3 Protein, Human (HEK293, His) is the recombinant human-derived GALNT3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

GALNT3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/galnt3-protein-human-hek-293-his.html

Purity

95.0

Smiles

QREVSVQYSKEESRMERNMKNKNKMLDLMLEAVNNIKDAMPKMQIGAPVRQNIDAGERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKAFKTTNLSVEEQKEKERGEAKHCFNAFASDRISLHRDLGPDTRPPECIEQKFKRCPPLPTTSVIIVFHNEAWSTLLRTVHSVLYSSPAILLKEIILVDDASVDEYLHDKLDEYVKQFSIVKIVRQRERKGLITARLLGATVATAETLTFLDAHCECFYGWLEPLLARIAENYTAVVSPDIASIDLNTFEFNKPSPYGSNHNRGNFDWSLSFGWESLPDHEKQRRKDETYPIKTPTFAGGLFSISKEYFEYIGSYDEEMEIWGGENIEMSFRVWQCGGQLEIMPCSVVGHVFRSKSPHSFPKGTQVIARNQVRLAEVWMDEYKEIFYRRNTDAAKIVKQKAFGDLSKRFEIKHRLQCKNFTWYLNNIYPEVYVPDLNPVISGYIKSVGQPLCLDVGENNQGGKPLIMYTCHGLGGNQYFEYSAQHEIRHNIQKELCLHAAQGLVQLKACTYKGHKTVVTGEQIWEIQKDQLLYNPFLKMCLSANGEHPSLVSCNPSDPLQKWILSQND

Molecular Formula

2591 (Gene_ID) Q14435-1 (Q38-D633) (Accession)

Molecular Weight

Approximately 80.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRD5A3 Protein Vector (Mouse) (pPM-C-HA)
45446024 500 ng

SRD5A3 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
EGF Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV678201 1.0 µg DNA

EGF Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
P53 (Phospho-Ser9) Polyclonal Antibody
E012214 100 µg -100 µL

P53 (Phospho-Ser9) Polyclonal Antibody

Sign In for Pricing
View Details
C11ORF46 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-9932R-PerCP-Cy5.5 100 µL

C11ORF46 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
Streptavidin
32-4988-10 10 mg

Streptavidin

Sign In for Pricing
View Details
pLV3-U6-NSUN4-shRNA1-CopGFP-Puro Plasmid
PVT48404 2 µg

pLV3-U6-NSUN4-shRNA1-CopGFP-Puro Plasmid

Sign In for Pricing
View Details