Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFRSF3/LTBR, Mouse (HEK293, Fc)

TNFRSF3/LTBR Protein, Mouse (HEK293, Fc) is a cell surface receptor for apoptotic and cytokine-released lymphotoxins involved in activation of gene transcription programs and cell death, and is important in immune development and host defense. TNFRSF3/LTBR Protein, Mouse (HEK293, Fc) is expressed by HEK293 cells and is a transmembrane protein with a Fc tag at the C-terminus[1].

Product Specifications

Product Name Alternative

TNFRSF3/LTBR Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnfrsf3-ltbr-protein-mouse-hek-293-fc.html

Purity

95.0

Smiles

SQPQLVPPYRIENQTCWDQDKEYYEPMHDVCCSRCPPGEFVFAVCSRSQDTVCKTCPHNSYNEHWNHLSTCQLCRPCDIVLGFEEVAPCTSDRKAECRCQPGMSCVYLDNECVHCEEERLVLCQPGTEAEVTDEIMDTDVNCVPCKPGHFQNTSSPRARCQPHTRCEIQGLVEAAPGTSYSDTICKNPPEP

Molecular Formula

17000 (Gene_ID) P50284 (S28-P218) (Accession)

Molecular Weight

Approximately 61.0 kDa

References & Citations

[1]Norris PS, et al. The LT beta R signaling pathway. Adv Exp Med Biol. 2007;597:160-72.|[2]Mo Shen, et al. Lymphotoxin β receptor activation promotes mRNA expression of RelA and pro-inflammatory cytokines TNFα and IL-1β in bladder cancer cells. Mol Med Rep. 2017 Jul;16 (1) :937-942.|[3]Fütterer A, et al. The lymphotoxin beta receptor controls organogenesis and affinity maturation in peripheral lymphoid tissues. Immunity. 1998 Jul;9 (1) :59-70.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Fumarate reductase subunit C (frdC)
orb2932789-01 20 µg

Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Fumarate reductase subunit C (frdC)

Sign In for Pricing
View Details
Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Fumarate reductase subunit C (frdC)
orb2932789-02 100 µg

Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Fumarate reductase subunit C (frdC)

Sign In for Pricing
View Details
Trim10 Mouse Gene Knockout Kit (CRISPR)
KN518180 1 Kit

Trim10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Sodium tetraborate decahydrate (Borax decahydrate)
90033806 1 Kg

Sodium tetraborate decahydrate (Borax decahydrate)

Sign In for Pricing
View Details
Human Cartilage Oligomeric Matrix Protein ELISA Kit
MBS727045-01 48 Well

Human Cartilage Oligomeric Matrix Protein ELISA Kit

Sign In for Pricing
View Details
Human Cartilage Oligomeric Matrix Protein ELISA Kit
MBS727045-02 96 Well

Human Cartilage Oligomeric Matrix Protein ELISA Kit

Sign In for Pricing
View Details