Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF-C, Human (116a.a, HEK293, His)

The VEGF-C protein is a potent growth factor in angiogenesis and endothelial cell growth, stimulating cell proliferation and migration while affecting vascular permeability. It plays a critical role in embryonic vein and lymphangiogenesis and maintains adult differentiated lymphatic endothelium. VEGF-C Protein, Human (116a.a, HEK293, His) is the recombinant human-derived VEGF-C protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VEGF-C Protein, Human (116a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf-c-protein-human-116a-a-hek293-his.html

Purity

95.0

Smiles

AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

Molecular Formula

7424 (Gene_ID) P49767 (A112-R227) (Accession)

Molecular Weight

Approximately 19.4 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTPAL (NM_024331) Human Tagged ORF Clone Lentiviral Particle
RC200776L4V 200 µL

TTPAL (NM_024331) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit Polyclonal TSG-9 Antibody [DyLight 550]
NBP3-05875R 0.1 mL

Rabbit Polyclonal TSG-9 Antibody [DyLight 550]

Sign In for Pricing
View Details
Lentiviral human NCBP3 shRNA (UAS) - Lentiviral human NCBP3 shRNA (UAS, RFP) (100)
GTR15110376 1 Vial

Lentiviral human NCBP3 shRNA (UAS) - Lentiviral human NCBP3 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Organelle Marker-Plasma Memberane
RC100017 10 µg

Organelle Marker-Plasma Memberane

Sign In for Pricing
View Details
Zic2 (NM_009574) Mouse Tagged Lenti ORF Clone
MR222078L2 10 µg

Zic2 (NM_009574) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PT7-6xHis-SUMO-ACKR3 Plasmid
PVT64593 2 µg

PT7-6xHis-SUMO-ACKR3 Plasmid

Sign In for Pricing
View Details