Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF-C, Human (116a.a, HEK293, His)

The VEGF-C protein is a potent growth factor in angiogenesis and endothelial cell growth, stimulating cell proliferation and migration while affecting vascular permeability. It plays a critical role in embryonic vein and lymphangiogenesis and maintains adult differentiated lymphatic endothelium. VEGF-C Protein, Human (116a.a, HEK293, His) is the recombinant human-derived VEGF-C protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VEGF-C Protein, Human (116a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf-c-protein-human-116a-a-hek293-his.html

Purity

95.0

Smiles

AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

Molecular Formula

7424 (Gene_ID) P49767 (A112-R227) (Accession)

Molecular Weight

Approximately 19.4 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amphiphysin antibody
70R-3809 50 ug

Amphiphysin antibody

Sign In for Pricing
View Details
Lentiviral human CCL8 shRNA (UAS) - Lentiviral human CCL8 shRNA (UAS) (25)
GTR15310112 1 Vial

Lentiviral human CCL8 shRNA (UAS) - Lentiviral human CCL8 shRNA (UAS) (25)

Sign In for Pricing
View Details
Human CNG1 (CNGA1) (NM_001142564) AAV Particle
RC227648A1V 250 µL

Human CNG1 (CNGA1) (NM_001142564) AAV Particle

Sign In for Pricing
View Details
4922501L14Rik Protein Vector (Mouse) (pPB-N-His)
PV148987 500 ng

4922501L14Rik Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Anti-CD3 & SSTR2 Antibody (Tidutamab)
F1179-5 5 mg

Anti-CD3 & SSTR2 Antibody (Tidutamab)

Sign In for Pricing
View Details
Zfp607 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
51046114 3x 1.0 µg

Zfp607 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details