Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF-C, Human (116a.a, HEK293, His)

The VEGF-C protein is a potent growth factor in angiogenesis and endothelial cell growth, stimulating cell proliferation and migration while affecting vascular permeability. It plays a critical role in embryonic vein and lymphangiogenesis and maintains adult differentiated lymphatic endothelium. VEGF-C Protein, Human (116a.a, HEK293, His) is the recombinant human-derived VEGF-C protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VEGF-C Protein, Human (116a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf-c-protein-human-116a-a-hek293-his.html

Purity

95.0

Smiles

AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

Molecular Formula

7424 (Gene_ID) P49767 (A112-R227) (Accession)

Molecular Weight

Approximately 19.4 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Pannexin-1 Antibody
NBP2-97446-100ul 100 µL

Rabbit Polyclonal Pannexin-1 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Survivin Antibody (91630) [PerCP]
FAB886C 0.1 mL

Mouse Monoclonal Survivin Antibody (91630) [PerCP]

Sign In for Pricing
View Details
TNPO3 Protein Lysate (Mouse) with C-HA Tag
47257034 100 µg

TNPO3 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Recombinant Human AGPAT1 Protein - (Dry Ice)
H00010554-P01-10ug 10 µg

Recombinant Human AGPAT1 Protein - (Dry Ice)

Sign In for Pricing
View Details
GENLISA Human Hepatitis G Virus IgG (HGV-IgG) ELISA
KBH11504 1x 96 Well

GENLISA Human Hepatitis G Virus IgG (HGV-IgG) ELISA

Sign In for Pricing
View Details
Recombinant Mouse VSIG2 Fc Chimera Protein CF
9598-VS-050 50 µg

Recombinant Mouse VSIG2 Fc Chimera Protein CF

Sign In for Pricing
View Details