Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF-C, Human (116a.a, HEK293, His)

The VEGF-C protein is a potent growth factor in angiogenesis and endothelial cell growth, stimulating cell proliferation and migration while affecting vascular permeability. It plays a critical role in embryonic vein and lymphangiogenesis and maintains adult differentiated lymphatic endothelium. VEGF-C Protein, Human (116a.a, HEK293, His) is the recombinant human-derived VEGF-C protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VEGF-C Protein, Human (116a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf-c-protein-human-116a-a-hek293-his.html

Purity

95.0

Smiles

AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

Molecular Formula

7424 (Gene_ID) P49767 (A112-R227) (Accession)

Molecular Weight

Approximately 19.4 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Integrin beta 1 Recombinant Antibody, PE-Cy5.5 Conjugated
bsm-52266R-PE-Cy5.5 100 µL

Integrin beta 1 Recombinant Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
Lentiviral human GJA5 shRNA (UAS) - Lentiviral human GJA5 shRNA (UAS) plasmid
GTR15144367 1 Vial

Lentiviral human GJA5 shRNA (UAS) - Lentiviral human GJA5 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Anti-N-Acetylprocainamide Antibody
16904 100ug

Anti-N-Acetylprocainamide Antibody

Sign In for Pricing
View Details
ELISA kit for Rat PKM2 (Pyruvate Kinase, Muscle)
E-EL-R0838 96 Tests

ELISA kit for Rat PKM2 (Pyruvate Kinase, Muscle)

Sign In for Pricing
View Details
DST Protein Vector (Mouse) (pPM-C-His)
PV173525 500 ng

DST Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
PPP2R1A 3'UTR Luciferase Stable Cell Line
TU018678 1.0 mL

PPP2R1A 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details