VEGF-C, Human (116a.a, HEK293, His)
The VEGF-C protein is a potent growth factor in angiogenesis and endothelial cell growth, stimulating cell proliferation and migration while affecting vascular permeability. It plays a critical role in embryonic vein and lymphangiogenesis and maintains adult differentiated lymphatic endothelium. VEGF-C Protein, Human (116a.a, HEK293, His) is the recombinant human-derived VEGF-C protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
VEGF-C Protein, Human (116a.a, HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/vegf-c-protein-human-116a-a-hek293-his.html
Purity
95.0
Smiles
AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR
Molecular Formula
7424 (Gene_ID) P49767 (A112-R227) (Accession)
Molecular Weight
Approximately 19.4 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
C13orf7 (RNF219) Human shRNA Plasmid Kit (Locus ID 79596)
Heated Circulator, 20L, Advanced Programmable (Ambient +10° to 200°C), 120V, 60Hz
Crotonyl-Histone H2B (Lys12) Recombinant Rabbit mAb
Sar1a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
Human Anti-diuretic hormone/vasopressin/arginine vasopressin (ADH/VP/AVP) ELISA Kit