Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF-C, Human (116a.a, HEK293, His)

The VEGF-C protein is a potent growth factor in angiogenesis and endothelial cell growth, stimulating cell proliferation and migration while affecting vascular permeability. It plays a critical role in embryonic vein and lymphangiogenesis and maintains adult differentiated lymphatic endothelium. VEGF-C Protein, Human (116a.a, HEK293, His) is the recombinant human-derived VEGF-C protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VEGF-C Protein, Human (116a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf-c-protein-human-116a-a-hek293-his.html

Purity

95.0

Smiles

AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

Molecular Formula

7424 (Gene_ID) P49767 (A112-R227) (Accession)

Molecular Weight

Approximately 19.4 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPAIN AAV Vector (Rat) (CMV)
40713106 1 µg

RPAIN AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Srd5a3 (NM_020611) Mouse Tagged Lenti ORF Clone
MR226010L4 10 µg

Srd5a3 (NM_020611) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal GLRB Antibody [mFluor Violet 450 SE]
NBP2-97806MFV450 0.1 mL

Rabbit Polyclonal GLRB Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Rabbit Anti-Human IgG H&L Secondary Antibody-RBITC
MF-0011297-01 100 µL

Rabbit Anti-Human IgG H&L Secondary Antibody-RBITC

Sign In for Pricing
View Details
Rabbit Anti-Human IgG H&L Secondary Antibody-RBITC
MF-0011297-02 1 mL

Rabbit Anti-Human IgG H&L Secondary Antibody-RBITC

Sign In for Pricing
View Details
Plasminogen, Human (PLG) discontinued
301265 1 mg

Plasminogen, Human (PLG) discontinued

Sign In for Pricing
View Details