Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF-C, Human (116a.a, HEK293, His)

The VEGF-C protein is a potent growth factor in angiogenesis and endothelial cell growth, stimulating cell proliferation and migration while affecting vascular permeability. It plays a critical role in embryonic vein and lymphangiogenesis and maintains adult differentiated lymphatic endothelium. VEGF-C Protein, Human (116a.a, HEK293, His) is the recombinant human-derived VEGF-C protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VEGF-C Protein, Human (116a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf-c-protein-human-116a-a-hek293-his.html

Purity

95.0

Smiles

AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

Molecular Formula

7424 (Gene_ID) P49767 (A112-R227) (Accession)

Molecular Weight

Approximately 19.4 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

R3hdml sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
38287114 3x 1.0 µg

R3hdml sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Myo10 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4779604 1.0 µg DNA

Myo10 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
NR12S
7509/100U 100 µg

NR12S

Sign In for Pricing
View Details
EDN1 (Endothelin-1, PPET1, ET-1, ET1, HDLCQ7) (MaxLight 490)
MBS6415018-01 0.1 mL

EDN1 (Endothelin-1, PPET1, ET-1, ET1, HDLCQ7) (MaxLight 490)

Sign In for Pricing
View Details
EDN1 (Endothelin-1, PPET1, ET-1, ET1, HDLCQ7) (MaxLight 490)
MBS6415018-02 5x 0.1 mL

EDN1 (Endothelin-1, PPET1, ET-1, ET1, HDLCQ7) (MaxLight 490)

Sign In for Pricing
View Details
LRRIQ3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV660704 1.0 µg DNA

LRRIQ3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details