Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Complement factor D (Cfd)

Product Specifications

Product Name Alternative

Adipsin (C3 convertase activator) (Endogenous vascular elastase) (Properdin factor D)

Abbreviation

Recombinant Rat Cfd protein

Gene Name

Cfd

UniProt

P32038

Expression Region

26-263aa

Organism

Rattus norvegicus (Rat)

Target Sequence

ILGGQEAMAHARPYMASVQVNGTHVCGGTLVDEQWVLSAAHCMDGVTKDEVVQVLLGAHSLSSPEPYKHLYDVQSVVLHPGSRPDSVEDDLMLFKLSHNASLGPHVRPLPLQREDREVKPGTLCDVAGWGVVTHAGRRPDVLQQLTVSIMDRNTCNLRTYHDGAITKNMMCAESNRRDTCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRKPGVFTRVATYVPWIENVLSGNVSVNVTA

Tag

C-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Immunology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

53.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smcp sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
44436114 3x 1.0 µg

Smcp sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Human Claudin 8, CLDN8 ELISA KIT
E2306Hu-01 48 Well

Human Claudin 8, CLDN8 ELISA KIT

Sign In for Pricing
View Details
Human Claudin 8, CLDN8 ELISA KIT
E2306Hu-02 96 Well

Human Claudin 8, CLDN8 ELISA KIT

Sign In for Pricing
View Details
Human Claudin 8, CLDN8 ELISA KIT
E2306Hu-03 5x 96 Tests

Human Claudin 8, CLDN8 ELISA KIT

Sign In for Pricing
View Details
Human Claudin 8, CLDN8 ELISA KIT
E2306Hu-04 10x 96 Tests

Human Claudin 8, CLDN8 ELISA KIT

Sign In for Pricing
View Details
N-Desmethyl Asenapine Hydrochloride
CS-T-73314 1 Each

N-Desmethyl Asenapine Hydrochloride

Sign In for Pricing
View Details