Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Blomia tropicalis Major allergen Blo t 12

Product Specifications

Product Name Alternative

(allergen Blo t 12)

Abbreviation

Recombinant Blomia tropicalis Major allergen Blo t 12 protein

UniProt

Q17282

Expression Region

21-144aa

Organism

Blomia tropicalis (Mite)

Target Sequence

ADEQTTRGRHTEPDDHHEKPTTQCTHEETTSTQHHHEEVVTTQTPHHEEKTTTEETHHSDDLIVHEGGKTYHVVCHEEGPIHIQEMCNKYIICSKSGSLWYITVMPCSIGTKFDPISRNCVLDN

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.3 kDa

References & Citations

"Nucleotide sequence analysis of a complementary DNA coding for a Blomia tropicalis allergen." Puerta L., Caraballo L., Fernandez-Caldas E., Avjioglu A., Marsh D.G., Lockey R.F., Dao M.L. J. Allergy Clin. Immunol. 98:932-937 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polypyrimidine Tract-Binding Protein 3 (PTBP3) Antibody
abx344338-01 20 µL

Polypyrimidine Tract-Binding Protein 3 (PTBP3) Antibody

Sign In for Pricing
View Details
Polypyrimidine Tract-Binding Protein 3 (PTBP3) Antibody
abx344338-02 50 µL

Polypyrimidine Tract-Binding Protein 3 (PTBP3) Antibody

Sign In for Pricing
View Details
Polypyrimidine Tract-Binding Protein 3 (PTBP3) Antibody
abx344338-03 100 µL

Polypyrimidine Tract-Binding Protein 3 (PTBP3) Antibody

Sign In for Pricing
View Details
Polypyrimidine Tract-Binding Protein 3 (PTBP3) Antibody
abx344338-04 200 µL

Polypyrimidine Tract-Binding Protein 3 (PTBP3) Antibody

Sign In for Pricing
View Details
Polypyrimidine Tract-Binding Protein 3 (PTBP3) Antibody
abx344338-05 1 mL

Polypyrimidine Tract-Binding Protein 3 (PTBP3) Antibody

Sign In for Pricing
View Details
Elongation Factor Tu GTP-Binding Domain-Containing Protein 2 (EFTUD2) Antibody
abx325971-01 50 µg

Elongation Factor Tu GTP-Binding Domain-Containing Protein 2 (EFTUD2) Antibody

Sign In for Pricing
View Details