Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EVI2A, Human (HEK293, Fc)

EVI2A may be a component of a cell surface receptor that forms a complex with itself or other proteins within the membrane, suggesting a role in mediating cellular responses through complex molecular interactions. Its ability to participate in self-complex formation or to interact with other proteins implies involvement in the organization of membrane-associated receptor structures. EVI2A Protein, Human (HEK293, Fc) is the recombinant human-derived EVI2A protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

EVI2A Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/evi2a-protein-human-hek293-fc.html

Purity

96.0

Smiles

NYTRLWANSTSSWDSVIQNKTGRNQNENINTNPITPEVDYKGNSTNMPETSHIVALTSKSEQELYIPSVVSNSPSTVQSIENTSKSHGEIFKKDVCAENNNNM

Molecular Formula

2123 (Gene_ID) P22794-1/NP_055025.2 (N31-M133) (Accession)

Molecular Weight

Approximately 70-80 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Complement C7 Antibody [Alexa Fluor 594]
NBP3-00202AF594 0.1 mL

Rabbit Polyclonal Complement C7 Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
SMYD4, CT (SMYD4, KIAA1936, SET and MYND domain-containing protein 4) (MaxLight 650) discontinued
042070-ML650 100 µL

SMYD4, CT (SMYD4, KIAA1936, SET and MYND domain-containing protein 4) (MaxLight 650) discontinued

Sign In for Pricing
View Details
PCGF2 (polycomb Group Ring Finger 2, MEL-18, MGC10545, RNF110, ZNF144) (FITC)
MBS6177423-01 0.1 mL

PCGF2 (polycomb Group Ring Finger 2, MEL-18, MGC10545, RNF110, ZNF144) (FITC)

Sign In for Pricing
View Details
PCGF2 (polycomb Group Ring Finger 2, MEL-18, MGC10545, RNF110, ZNF144) (FITC)
MBS6177423-02 5x 0.1 mL

PCGF2 (polycomb Group Ring Finger 2, MEL-18, MGC10545, RNF110, ZNF144) (FITC)

Sign In for Pricing
View Details
FOXF1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0006707 1.0 µg DNA

FOXF1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
NF2/Merlin Overexpression Lysate (Native) - (Dry Ice)
NBL1-13605 0.1 mg

NF2/Merlin Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details