Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EVI2A, Human (HEK293, Fc)

EVI2A may be a component of a cell surface receptor that forms a complex with itself or other proteins within the membrane, suggesting a role in mediating cellular responses through complex molecular interactions. Its ability to participate in self-complex formation or to interact with other proteins implies involvement in the organization of membrane-associated receptor structures. EVI2A Protein, Human (HEK293, Fc) is the recombinant human-derived EVI2A protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

EVI2A Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/evi2a-protein-human-hek293-fc.html

Purity

96.0

Smiles

NYTRLWANSTSSWDSVIQNKTGRNQNENINTNPITPEVDYKGNSTNMPETSHIVALTSKSEQELYIPSVVSNSPSTVQSIENTSKSHGEIFKKDVCAENNNNM

Molecular Formula

2123 (Gene_ID) P22794-1/NP_055025.2 (N31-M133) (Accession)

Molecular Weight

Approximately 70-80 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ppara Rabbit Polyclonal Antibody
TA397426S 25 µL

Ppara Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Vegfb 3'UTR Luciferase Stable Cell Line
TU121752 1.0 mL

Vegfb 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
PSMC1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV713888 1.0 µg DNA

PSMC1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
TAZ (NM_000116) Human Tagged ORF Clone Lentiviral Particle
RC218841L1V 200 µL

TAZ (NM_000116) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human TRPV1 (Transient Receptor Potential Cation Channel Subfamily V, Member 1) ELISA Kit
ELK3768-01 48 Tests

Human TRPV1 (Transient Receptor Potential Cation Channel Subfamily V, Member 1) ELISA Kit

Sign In for Pricing
View Details
Human TRPV1 (Transient Receptor Potential Cation Channel Subfamily V, Member 1) ELISA Kit
ELK3768-02 96 Tests

Human TRPV1 (Transient Receptor Potential Cation Channel Subfamily V, Member 1) ELISA Kit

Sign In for Pricing
View Details