Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EVI2A, Human (HEK293, Fc)

EVI2A may be a component of a cell surface receptor that forms a complex with itself or other proteins within the membrane, suggesting a role in mediating cellular responses through complex molecular interactions. Its ability to participate in self-complex formation or to interact with other proteins implies involvement in the organization of membrane-associated receptor structures. EVI2A Protein, Human (HEK293, Fc) is the recombinant human-derived EVI2A protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

EVI2A Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/evi2a-protein-human-hek293-fc.html

Purity

96.0

Smiles

NYTRLWANSTSSWDSVIQNKTGRNQNENINTNPITPEVDYKGNSTNMPETSHIVALTSKSEQELYIPSVVSNSPSTVQSIENTSKSHGEIFKKDVCAENNNNM

Molecular Formula

2123 (Gene_ID) P22794-1/NP_055025.2 (N31-M133) (Accession)

Molecular Weight

Approximately 70-80 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCEA2 Recombinant Protein (Human)
RP031114 100 µg

TCEA2 Recombinant Protein (Human)

Sign In for Pricing
View Details
CX3CL1 (NM_002996) Human Tagged Lenti ORF Clone
RC200420L2 10 µg

CX3CL1 (NM_002996) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PD-L1 (CD274) Mouse Monoclonal Antibody [Clone ID: OTI9E1]
CF812997 100 µg

PD-L1 (CD274) Mouse Monoclonal Antibody [Clone ID: OTI9E1]

Sign In for Pricing
View Details
SEMA4F (Semaphorin-4F, Semaphorin-M, Sema M, Semaphorin-W, Sema W, SEMA4F, SEMAM, SEMAW) (MaxLight 750) discontinued
302739-ML750 100 µL

SEMA4F (Semaphorin-4F, Semaphorin-M, Sema M, Semaphorin-W, Sema W, SEMA4F, SEMAM, SEMAW) (MaxLight 750) discontinued

Sign In for Pricing
View Details
SPIRE2 (NM_032451) Human Tagged Lenti ORF Clone
RC215650L2 10 µg

SPIRE2 (NM_032451) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Human EXO5 Protein, His (Fc)-Avi-tagged
EXO5-877H 50 µg

Recombinant Human EXO5 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details