Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EVI2A, Human (HEK293, Fc)

EVI2A may be a component of a cell surface receptor that forms a complex with itself or other proteins within the membrane, suggesting a role in mediating cellular responses through complex molecular interactions. Its ability to participate in self-complex formation or to interact with other proteins implies involvement in the organization of membrane-associated receptor structures. EVI2A Protein, Human (HEK293, Fc) is the recombinant human-derived EVI2A protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

EVI2A Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/evi2a-protein-human-hek293-fc.html

Purity

96.0

Smiles

NYTRLWANSTSSWDSVIQNKTGRNQNENINTNPITPEVDYKGNSTNMPETSHIVALTSKSEQELYIPSVVSNSPSTVQSIENTSKSHGEIFKKDVCAENNNNM

Molecular Formula

2123 (Gene_ID) P22794-1/NP_055025.2 (N31-M133) (Accession)

Molecular Weight

Approximately 70-80 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FYB1 Mouse Monoclonal Antibody [Clone ID: 2H9-H6-G10]
TA384271 100 µL

FYB1 Mouse Monoclonal Antibody [Clone ID: 2H9-H6-G10]

Sign In for Pricing
View Details
GDF5, NT (Growth/Differentiation Factor 5, GDF-5, Cartilage-derived Morphogenetic Protein 1, CDMP-1, Radotermin, CDMP1) (MaxLight 490) discontinued
G8989-45C-ML490 100 µL

GDF5, NT (Growth/Differentiation Factor 5, GDF-5, Cartilage-derived Morphogenetic Protein 1, CDMP-1, Radotermin, CDMP1) (MaxLight 490) discontinued

Sign In for Pricing
View Details
GPR42 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV762392 1.0 µg DNA

GPR42 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
FABP6 (Fatty Acid Binding Protein 6, Ileal) BioAssayTM ELISA Kit (Human) discontinued
382819 96 Tests

FABP6 (Fatty Acid Binding Protein 6, Ileal) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
Human IL-22 Protein, His Tag (MALS verified)
IL2-H524a-50ug 50 µg

Human IL-22 Protein, His Tag (MALS verified)

Sign In for Pricing
View Details
Akap1 Mouse qPCR Primer Pair (NM_009648)
MP200151 200 Reactions

Akap1 Mouse qPCR Primer Pair (NM_009648)

Sign In for Pricing
View Details