Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EVI2A, Human (HEK293, Fc)

EVI2A may be a component of a cell surface receptor that forms a complex with itself or other proteins within the membrane, suggesting a role in mediating cellular responses through complex molecular interactions. Its ability to participate in self-complex formation or to interact with other proteins implies involvement in the organization of membrane-associated receptor structures. EVI2A Protein, Human (HEK293, Fc) is the recombinant human-derived EVI2A protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

EVI2A Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/evi2a-protein-human-hek293-fc.html

Purity

96.0

Smiles

NYTRLWANSTSSWDSVIQNKTGRNQNENINTNPITPEVDYKGNSTNMPETSHIVALTSKSEQELYIPSVVSNSPSTVQSIENTSKSHGEIFKKDVCAENNNNM

Molecular Formula

2123 (Gene_ID) P22794-1/NP_055025.2 (N31-M133) (Accession)

Molecular Weight

Approximately 70-80 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR10AE3P sgRNA CRISPR Lentivector set (Human)
K1550501 3x 1.0 µg

OR10AE3P sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal LIF Antibody [Alexa Fluor 532]
NBP1-76554AF532 0.1 mL

Rabbit Polyclonal LIF Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
Rabbit Anti-Human NOP10 pAb
PA11674-01 50 μL

Rabbit Anti-Human NOP10 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human NOP10 pAb
PA11674-02 100 μL

Rabbit Anti-Human NOP10 pAb

Sign In for Pricing
View Details
SHLP-5
MF-0126565-01 10 mg

SHLP-5

Sign In for Pricing
View Details
SHLP-5
MF-0126565-02 50 mg

SHLP-5

Sign In for Pricing
View Details