Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EVI2A, Human (HEK293, Fc)

EVI2A may be a component of a cell surface receptor that forms a complex with itself or other proteins within the membrane, suggesting a role in mediating cellular responses through complex molecular interactions. Its ability to participate in self-complex formation or to interact with other proteins implies involvement in the organization of membrane-associated receptor structures. EVI2A Protein, Human (HEK293, Fc) is the recombinant human-derived EVI2A protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

EVI2A Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/evi2a-protein-human-hek293-fc.html

Purity

96.0

Smiles

NYTRLWANSTSSWDSVIQNKTGRNQNENINTNPITPEVDYKGNSTNMPETSHIVALTSKSEQELYIPSVVSNSPSTVQSIENTSKSHGEIFKKDVCAENNNNM

Molecular Formula

2123 (Gene_ID) P22794-1/NP_055025.2 (N31-M133) (Accession)

Molecular Weight

Approximately 70-80 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal BTAF1 Antibody [DyLight 550]
NB100-57504R 0.1 mL

Rabbit Polyclonal BTAF1 Antibody [DyLight 550]

Sign In for Pricing
View Details
PPP1R7 (NM_002712) Human Over-expression Lysate
LC400956 20 µg

PPP1R7 (NM_002712) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Monoclonal Bone marrow stromal cell antigen 1/CD157 Antibody (SY11B5) [Alexa Fluor 532]
NBP2-37711AF532 0.1 mL

Mouse Monoclonal Bone marrow stromal cell antigen 1/CD157 Antibody (SY11B5) [Alexa Fluor 532]

Sign In for Pricing
View Details
2-Chlorobenzyl cyanide
abx183168-01 25 g

2-Chlorobenzyl cyanide

Sign In for Pricing
View Details
2-Chlorobenzyl cyanide
abx183168-02 100 g

2-Chlorobenzyl cyanide

Sign In for Pricing
View Details
2-Chlorobenzyl cyanide
abx183168-03 500 g

2-Chlorobenzyl cyanide

Sign In for Pricing
View Details