Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EVI2A, Human (HEK293, Fc)

EVI2A may be a component of a cell surface receptor that forms a complex with itself or other proteins within the membrane, suggesting a role in mediating cellular responses through complex molecular interactions. Its ability to participate in self-complex formation or to interact with other proteins implies involvement in the organization of membrane-associated receptor structures. EVI2A Protein, Human (HEK293, Fc) is the recombinant human-derived EVI2A protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

EVI2A Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/evi2a-protein-human-hek293-fc.html

Purity

96.0

Smiles

NYTRLWANSTSSWDSVIQNKTGRNQNENINTNPITPEVDYKGNSTNMPETSHIVALTSKSEQELYIPSVVSNSPSTVQSIENTSKSHGEIFKKDVCAENNNNM

Molecular Formula

2123 (Gene_ID) P22794-1/NP_055025.2 (N31-M133) (Accession)

Molecular Weight

Approximately 70-80 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rbm13 (BC013079) Mouse Tagged Lenti ORF Clone
MR203971L4 10 µg

Rbm13 (BC013079) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Prtn3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
37878114 3x 1.0 µg

Prtn3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Gal-β1,3-GalNAc-β-OMe
HY-W145663 1 Each

Gal-β1,3-GalNAc-β-OMe

Sign In for Pricing
View Details
Mouse Monoclonal DMRT2 Antibody (PCRP-DMRT2-1B11) [PE]
NBP3-14270PE 0.1 mL

Mouse Monoclonal DMRT2 Antibody (PCRP-DMRT2-1B11) [PE]

Sign In for Pricing
View Details
GENLISA™ Human staphylococcus aureus enterotoxins (SE) ELISA
KBH2070 1x 96 Well

GENLISA™ Human staphylococcus aureus enterotoxins (SE) ELISA

Sign In for Pricing
View Details
Lentiviral mouse Zfp383 shRNA (UAS) - Lentiviral mouseZfp383 shRNA (UAS, GFP) (25)
GTR15268556 1 Vial

Lentiviral mouse Zfp383 shRNA (UAS) - Lentiviral mouseZfp383 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details