Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EVI2A, Human (HEK293, Fc)

EVI2A may be a component of a cell surface receptor that forms a complex with itself or other proteins within the membrane, suggesting a role in mediating cellular responses through complex molecular interactions. Its ability to participate in self-complex formation or to interact with other proteins implies involvement in the organization of membrane-associated receptor structures. EVI2A Protein, Human (HEK293, Fc) is the recombinant human-derived EVI2A protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

EVI2A Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/evi2a-protein-human-hek293-fc.html

Purity

96.0

Smiles

NYTRLWANSTSSWDSVIQNKTGRNQNENINTNPITPEVDYKGNSTNMPETSHIVALTSKSEQELYIPSVVSNSPSTVQSIENTSKSHGEIFKKDVCAENNNNM

Molecular Formula

2123 (Gene_ID) P22794-1/NP_055025.2 (N31-M133) (Accession)

Molecular Weight

Approximately 70-80 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Lrrc31 Pre-designed siRNA Set B
SI207810B 1 Each

Rat Lrrc31 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Mmu-miR-1198-5p mimic
HY-R02586-01 5 nmol

Mmu-miR-1198-5p mimic

Sign In for Pricing
View Details
Mmu-miR-1198-5p mimic
HY-R02586-02 20 nmol

Mmu-miR-1198-5p mimic

Sign In for Pricing
View Details
2610110G12Rik (BC028847) Mouse Tagged ORF Clone
MG206707 10 µg

2610110G12Rik (BC028847) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
NANOG (Putative Homeobox Protein NANOGP8, Nanog Homeobox)
486518 100 µL

NANOG (Putative Homeobox Protein NANOGP8, Nanog Homeobox)

Sign In for Pricing
View Details
Patatin-Like Phospholipase Domain-Containing Protein 6 (PNPLA6) Antibody
abx114340 100 µL

Patatin-Like Phospholipase Domain-Containing Protein 6 (PNPLA6) Antibody

Sign In for Pricing
View Details