Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EVI2A, Human (HEK293, Fc)

EVI2A may be a component of a cell surface receptor that forms a complex with itself or other proteins within the membrane, suggesting a role in mediating cellular responses through complex molecular interactions. Its ability to participate in self-complex formation or to interact with other proteins implies involvement in the organization of membrane-associated receptor structures. EVI2A Protein, Human (HEK293, Fc) is the recombinant human-derived EVI2A protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

EVI2A Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/evi2a-protein-human-hek293-fc.html

Purity

96.0

Smiles

NYTRLWANSTSSWDSVIQNKTGRNQNENINTNPITPEVDYKGNSTNMPETSHIVALTSKSEQELYIPSVVSNSPSTVQSIENTSKSHGEIFKKDVCAENNNNM

Molecular Formula

2123 (Gene_ID) P22794-1/NP_055025.2 (N31-M133) (Accession)

Molecular Weight

Approximately 70-80 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Def3 RNA Binding Protein (RBM6) Control Peptide discontinued
D1925P 1 mg

Def3 RNA Binding Protein (RBM6) Control Peptide discontinued

Sign In for Pricing
View Details
HELT (Hairy and Enhancer of Split-Related Protein HELT, Helt bHLH Transcription Factor)
482635 100 µL

HELT (Hairy and Enhancer of Split-Related Protein HELT, Helt bHLH Transcription Factor)

Sign In for Pricing
View Details
S100A11 Antibody, FITC conjugated
A34026-50UG 50 µg

S100A11 Antibody, FITC conjugated

Sign In for Pricing
View Details
Human Cluster Of Differentiation 73 (CD73) ELISA Kit
EKN43145 96 Tests

Human Cluster Of Differentiation 73 (CD73) ELISA Kit

Sign In for Pricing
View Details
MK 886 50mg
A13346-50 50 mg

MK 886 50mg

Sign In for Pricing
View Details
Pyrene-PEG-OH (MW 2000)
HY-174951A 1 Each

Pyrene-PEG-OH (MW 2000)

Sign In for Pricing
View Details