Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EVI2A, Human (HEK293, Fc)

EVI2A may be a component of a cell surface receptor that forms a complex with itself or other proteins within the membrane, suggesting a role in mediating cellular responses through complex molecular interactions. Its ability to participate in self-complex formation or to interact with other proteins implies involvement in the organization of membrane-associated receptor structures. EVI2A Protein, Human (HEK293, Fc) is the recombinant human-derived EVI2A protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

EVI2A Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/evi2a-protein-human-hek293-fc.html

Purity

96.0

Smiles

NYTRLWANSTSSWDSVIQNKTGRNQNENINTNPITPEVDYKGNSTNMPETSHIVALTSKSEQELYIPSVVSNSPSTVQSIENTSKSHGEIFKKDVCAENNNNM

Molecular Formula

2123 (Gene_ID) P22794-1/NP_055025.2 (N31-M133) (Accession)

Molecular Weight

Approximately 70-80 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vom2r30 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
50109156 3x 1.0 µg DNA

Vom2r30 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
CD5 (CD5 antigen (p56 62), LEU1, Ly12, LyA, Lymphocyte antigen T1/Leu-1, Lymphocyte glycoprotein T1/Leu1, T-cell surface glycoprotein CD5) (BSA & Azide Free) (MaxLight 750) discontinued
168704-AF-ML750 100 µL

CD5 (CD5 antigen (p56 62), LEU1, Ly12, LyA, Lymphocyte antigen T1/Leu-1, Lymphocyte glycoprotein T1/Leu1, T-cell surface glycoprotein CD5) (BSA & Azide Free) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal PPT1 Antibody (OTI1F10) [Alexa Fluor 488]
NBP2-73588AF488 0.1 mL

Mouse Monoclonal PPT1 Antibody (OTI1F10) [Alexa Fluor 488]

Sign In for Pricing
View Details
CD11b (Mac-1, alphaM integrin, Cr3, MO-1, C3bi Receptor) (PE)
C2262-35K-01 100 µg

CD11b (Mac-1, alphaM integrin, Cr3, MO-1, C3bi Receptor) (PE)

Sign In for Pricing
View Details
CD11b (Mac-1, alphaM integrin, Cr3, MO-1, C3bi Receptor) (PE)
C2262-35K-02 200 µg

CD11b (Mac-1, alphaM integrin, Cr3, MO-1, C3bi Receptor) (PE)

Sign In for Pricing
View Details
Neurofilament M, 160kD (NF-M)
N2160-04E 100 µg

Neurofilament M, 160kD (NF-M)

Sign In for Pricing
View Details