Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EVI2A, Human (HEK293, Fc)

EVI2A may be a component of a cell surface receptor that forms a complex with itself or other proteins within the membrane, suggesting a role in mediating cellular responses through complex molecular interactions. Its ability to participate in self-complex formation or to interact with other proteins implies involvement in the organization of membrane-associated receptor structures. EVI2A Protein, Human (HEK293, Fc) is the recombinant human-derived EVI2A protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

EVI2A Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/evi2a-protein-human-hek293-fc.html

Purity

96.0

Smiles

NYTRLWANSTSSWDSVIQNKTGRNQNENINTNPITPEVDYKGNSTNMPETSHIVALTSKSEQELYIPSVVSNSPSTVQSIENTSKSHGEIFKKDVCAENNNNM

Molecular Formula

2123 (Gene_ID) P22794-1/NP_055025.2 (N31-M133) (Accession)

Molecular Weight

Approximately 70-80 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

B3gnt4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6393805 3x 1.0 µg

B3gnt4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
HNRPA2B1 (Heterogeneous Nuclear Ribonucleoprotein A2/B1) Monkey ELISA Kit
E0822 96 Tests

HNRPA2B1 (Heterogeneous Nuclear Ribonucleoprotein A2/B1) Monkey ELISA Kit

Sign In for Pricing
View Details
ATP6V1B1, ID (ATP6V1B1, ATP6B1, VATB, VPP3, V-type proton ATPase subunit B, kidney isoform, Endomembrane proton pump 58kD subunit, Vacuolar proton pump subunit B 1) (APC) discontinued
032298-APC 200 µL

ATP6V1B1, ID (ATP6V1B1, ATP6B1, VATB, VPP3, V-type proton ATPase subunit B, kidney isoform, Endomembrane proton pump 58kD subunit, Vacuolar proton pump subunit B 1) (APC) discontinued

Sign In for Pricing
View Details
GRM3 Human Recombinant Protein, Synthetic Nanodisc
TP721689M 100 µg

GRM3 Human Recombinant Protein, Synthetic Nanodisc

Sign In for Pricing
View Details
SOHLH2, ID (SOHLH2, TEB1, Spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 2) (MaxLight 650) discontinued
042136-ML650 100 µL

SOHLH2, ID (SOHLH2, TEB1, Spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 2) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Human Interleukin-32 ELISA Kit
MBS765576-01 48 Well

Human Interleukin-32 ELISA Kit

Sign In for Pricing
View Details