Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EVI2A, Human (HEK293, Fc)

EVI2A may be a component of a cell surface receptor that forms a complex with itself or other proteins within the membrane, suggesting a role in mediating cellular responses through complex molecular interactions. Its ability to participate in self-complex formation or to interact with other proteins implies involvement in the organization of membrane-associated receptor structures. EVI2A Protein, Human (HEK293, Fc) is the recombinant human-derived EVI2A protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

EVI2A Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/evi2a-protein-human-hek293-fc.html

Purity

96.0

Smiles

NYTRLWANSTSSWDSVIQNKTGRNQNENINTNPITPEVDYKGNSTNMPETSHIVALTSKSEQELYIPSVVSNSPSTVQSIENTSKSHGEIFKKDVCAENNNNM

Molecular Formula

2123 (Gene_ID) P22794-1/NP_055025.2 (N31-M133) (Accession)

Molecular Weight

Approximately 70-80 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Entpd6 3'UTR Luciferase Stable Cell Line
TU204003 1.0 mL

Entpd6 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Ctf2 Rat shRNA Plasmid (Locus ID 293515)
TL708996 1 Kit

Ctf2 Rat shRNA Plasmid (Locus ID 293515)

Sign In for Pricing
View Details
Lentiviral human CACNA2D4 sgRNA gene knockout kit - Lentiviral human CACNA2D4 sgRNA gene knockout kit (plasmid)
GTR15397253 1 Vial

Lentiviral human CACNA2D4 sgRNA gene knockout kit - Lentiviral human CACNA2D4 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
LDHA Goat Polyclonal Antibody
TA396727S 25 µL

LDHA Goat Polyclonal Antibody

Sign In for Pricing
View Details
pCMV-SP100-3×FLAG-Neo Plasmid
PVT57178 2 µg

pCMV-SP100-3×FLAG-Neo Plasmid

Sign In for Pricing
View Details
PCMV-MRGPRX2-6xHis-Neo Plasmid
PVT74286 2 µg

PCMV-MRGPRX2-6xHis-Neo Plasmid

Sign In for Pricing
View Details