Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EVI2A, Human (HEK293, Fc)

EVI2A may be a component of a cell surface receptor that forms a complex with itself or other proteins within the membrane, suggesting a role in mediating cellular responses through complex molecular interactions. Its ability to participate in self-complex formation or to interact with other proteins implies involvement in the organization of membrane-associated receptor structures. EVI2A Protein, Human (HEK293, Fc) is the recombinant human-derived EVI2A protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

EVI2A Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/evi2a-protein-human-hek293-fc.html

Purity

96.0

Smiles

NYTRLWANSTSSWDSVIQNKTGRNQNENINTNPITPEVDYKGNSTNMPETSHIVALTSKSEQELYIPSVVSNSPSTVQSIENTSKSHGEIFKKDVCAENNNNM

Molecular Formula

2123 (Gene_ID) P22794-1/NP_055025.2 (N31-M133) (Accession)

Molecular Weight

Approximately 70-80 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EMA (MUC1) Mouse Monoclonal Antibody [Clone ID: OTI4A5]
CF800838 100 µg

EMA (MUC1) Mouse Monoclonal Antibody [Clone ID: OTI4A5]

Sign In for Pricing
View Details
Lentiviral mouse Slc22a30 shRNA (UAS) - Lentiviral mouse Slc22a30 shRNA (UAS) (25)
GTR15191345 1 Vial

Lentiviral mouse Slc22a30 shRNA (UAS) - Lentiviral mouse Slc22a30 shRNA (UAS) (25)

Sign In for Pricing
View Details
BET5 Polyclonal Antibody
JOT-AP00891-01 50ul

BET5 Polyclonal Antibody

Sign In for Pricing
View Details
BET5 Polyclonal Antibody
JOT-AP00891-02 100ul

BET5 Polyclonal Antibody

Sign In for Pricing
View Details
DSC1 Knockout HAP1 Polyclonal Cells
ARG39790 1 Million

DSC1 Knockout HAP1 Polyclonal Cells

Sign In for Pricing
View Details
Endonuclease V (ENDOV) (NM_001164637) Human Tagged Lenti ORF Clone
RC228168L4 10 µg

Endonuclease V (ENDOV) (NM_001164637) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details