Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EVI2A, Human (HEK293, Fc)

EVI2A may be a component of a cell surface receptor that forms a complex with itself or other proteins within the membrane, suggesting a role in mediating cellular responses through complex molecular interactions. Its ability to participate in self-complex formation or to interact with other proteins implies involvement in the organization of membrane-associated receptor structures. EVI2A Protein, Human (HEK293, Fc) is the recombinant human-derived EVI2A protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

EVI2A Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/evi2a-protein-human-hek293-fc.html

Purity

96.0

Smiles

NYTRLWANSTSSWDSVIQNKTGRNQNENINTNPITPEVDYKGNSTNMPETSHIVALTSKSEQELYIPSVVSNSPSTVQSIENTSKSHGEIFKKDVCAENNNNM

Molecular Formula

2123 (Gene_ID) P22794-1/NP_055025.2 (N31-M133) (Accession)

Molecular Weight

Approximately 70-80 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr537 Protein Vector (Rat) (pPM-C-His)
PV290369 500 ng

Olr537 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Mouse DUS1L Protein, His (Fc)-Avi-tagged
DUS1L-2558M 50 µg

Recombinant Mouse DUS1L Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Gm8229 Mouse siRNA Oligo Duplex (Locus ID 666675)
SR403842 1 Kit

Gm8229 Mouse siRNA Oligo Duplex (Locus ID 666675)

Sign In for Pricing
View Details
Col2a1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4341002 1.0 µg DNA

Col2a1 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Mouse Monoclonal beta 2-Microglobulin Antibody (SPM617) - Azide and BSA Free
NBP2-47703-0.1mg 0.1 mg

Mouse Monoclonal beta 2-Microglobulin Antibody (SPM617) - Azide and BSA Free

Sign In for Pricing
View Details
SDHALP1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
67293111 3x 1.0 µg

SDHALP1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details