Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EVI2A, Human (HEK293, Fc)

EVI2A may be a component of a cell surface receptor that forms a complex with itself or other proteins within the membrane, suggesting a role in mediating cellular responses through complex molecular interactions. Its ability to participate in self-complex formation or to interact with other proteins implies involvement in the organization of membrane-associated receptor structures. EVI2A Protein, Human (HEK293, Fc) is the recombinant human-derived EVI2A protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

EVI2A Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/evi2a-protein-human-hek293-fc.html

Purity

96.0

Smiles

NYTRLWANSTSSWDSVIQNKTGRNQNENINTNPITPEVDYKGNSTNMPETSHIVALTSKSEQELYIPSVVSNSPSTVQSIENTSKSHGEIFKKDVCAENNNNM

Molecular Formula

2123 (Gene_ID) P22794-1/NP_055025.2 (N31-M133) (Accession)

Molecular Weight

Approximately 70-80 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-Arginine hydrochloride, Ph. Eur., USP grade
GM0108-1kg 1 Kg

L-Arginine hydrochloride, Ph. Eur., USP grade

Sign In for Pricing
View Details
TGM5, CT (GX, TGM6, TGMX, TGASE5, TGASEX, Protein-glutamine gamma-glutamyltransferase 5, Transglutaminase X, TGX)
352587 100 µg

TGM5, CT (GX, TGM6, TGMX, TGASE5, TGASEX, Protein-glutamine gamma-glutamyltransferase 5, Transglutaminase X, TGX)

Sign In for Pricing
View Details
IFRD2 Lentiviral Activation Particles (h2)
sc-411120-LAC-2 200 µL

IFRD2 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
RPL23AP30 siRNA Oligos set (Human)
41154171 3x 5 nmol

RPL23AP30 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Anti-Corticotropin Releasing Factor Rabbit pAb
GB11706-50 50 μL

Anti-Corticotropin Releasing Factor Rabbit pAb

Sign In for Pricing
View Details
SPATA4 Rabbit pAb
A7608-01 20 µL

SPATA4 Rabbit pAb

Sign In for Pricing
View Details