Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EVI2A, Human (HEK293, Fc)

EVI2A may be a component of a cell surface receptor that forms a complex with itself or other proteins within the membrane, suggesting a role in mediating cellular responses through complex molecular interactions. Its ability to participate in self-complex formation or to interact with other proteins implies involvement in the organization of membrane-associated receptor structures. EVI2A Protein, Human (HEK293, Fc) is the recombinant human-derived EVI2A protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

EVI2A Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/evi2a-protein-human-hek293-fc.html

Purity

96.0

Smiles

NYTRLWANSTSSWDSVIQNKTGRNQNENINTNPITPEVDYKGNSTNMPETSHIVALTSKSEQELYIPSVVSNSPSTVQSIENTSKSHGEIFKKDVCAENNNNM

Molecular Formula

2123 (Gene_ID) P22794-1/NP_055025.2 (N31-M133) (Accession)

Molecular Weight

Approximately 70-80 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOC4L (NM_024078) Human Tagged ORF Clone
RC200983 10 µg

NOC4L (NM_024078) Human Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Monoclonal cGK1/PRKG1 Antibody (OTI9G4) [CoraFluor 1]
NBP2-71227CL1 0.1 mL

Mouse Monoclonal cGK1/PRKG1 Antibody (OTI9G4) [CoraFluor 1]

Sign In for Pricing
View Details
Anti-SDC4 Polyclonal Antibody
HB860014-01 50 µg

Anti-SDC4 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-SDC4 Polyclonal Antibody
HB860014-02 100 µg

Anti-SDC4 Polyclonal Antibody

Sign In for Pricing
View Details
TNNT1 (Troponin T Type 1 (Skeletal, slow), ANM, FLJ98147, MGC104241, STNT, TNT, TNTS) (HRP)
252859-HRP 100 µL

TNNT1 (Troponin T Type 1 (Skeletal, slow), ANM, FLJ98147, MGC104241, STNT, TNT, TNTS) (HRP)

Sign In for Pricing
View Details
TUBB6 AAV siRNA Pooled Vector
48818161 1.0 µg

TUBB6 AAV siRNA Pooled Vector

Sign In for Pricing
View Details