Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EVI2A, Human (HEK293, Fc)

EVI2A may be a component of a cell surface receptor that forms a complex with itself or other proteins within the membrane, suggesting a role in mediating cellular responses through complex molecular interactions. Its ability to participate in self-complex formation or to interact with other proteins implies involvement in the organization of membrane-associated receptor structures. EVI2A Protein, Human (HEK293, Fc) is the recombinant human-derived EVI2A protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

EVI2A Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/evi2a-protein-human-hek293-fc.html

Purity

96.0

Smiles

NYTRLWANSTSSWDSVIQNKTGRNQNENINTNPITPEVDYKGNSTNMPETSHIVALTSKSEQELYIPSVVSNSPSTVQSIENTSKSHGEIFKKDVCAENNNNM

Molecular Formula

2123 (Gene_ID) P22794-1/NP_055025.2 (N31-M133) (Accession)

Molecular Weight

Approximately 70-80 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Cathepsin E / CTSE Protein (His tag)
MBS2546915-01 0.05 mg

Recombinant Mouse Cathepsin E / CTSE Protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse Cathepsin E / CTSE Protein (His tag)
MBS2546915-02 5x 0.05 mg

Recombinant Mouse Cathepsin E / CTSE Protein (His tag)

Sign In for Pricing
View Details
CNBP Protein Vector (Mouse) (pPM-C-HA)
PV166596 500 ng

CNBP Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
HEXB Polyclonal Antibody
ANT-12515-50ug 50 µg

HEXB Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Streptococcus Thermophilus rplS Protein (aa 1-115)
VAng-Cr8435-500gEcoli 500 µg (E. coli)

Recombinant Streptococcus Thermophilus rplS Protein (aa 1-115)

Sign In for Pricing
View Details
Mtch2 (NM_019758) Mouse Tagged Lenti ORF Clone
MR204242L4 10 µg

Mtch2 (NM_019758) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details