Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EVI2A, Human (HEK293, Fc)

EVI2A may be a component of a cell surface receptor that forms a complex with itself or other proteins within the membrane, suggesting a role in mediating cellular responses through complex molecular interactions. Its ability to participate in self-complex formation or to interact with other proteins implies involvement in the organization of membrane-associated receptor structures. EVI2A Protein, Human (HEK293, Fc) is the recombinant human-derived EVI2A protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

EVI2A Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/evi2a-protein-human-hek293-fc.html

Purity

96.0

Smiles

NYTRLWANSTSSWDSVIQNKTGRNQNENINTNPITPEVDYKGNSTNMPETSHIVALTSKSEQELYIPSVVSNSPSTVQSIENTSKSHGEIFKKDVCAENNNNM

Molecular Formula

2123 (Gene_ID) P22794-1/NP_055025.2 (N31-M133) (Accession)

Molecular Weight

Approximately 70-80 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMACHC Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6H5]
TA504955AM 100 µL

MMACHC Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6H5]

Sign In for Pricing
View Details
Avutometinib potassium
MBS5810834 Inquire

Avutometinib potassium

Sign In for Pricing
View Details
PCDHGA3 sgRNA CRISPR Lentivector (Human) (Target 2)
K1607603 1.0 µg DNA

PCDHGA3 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Olr1469 Protein Vector (Rat) (pPM-C-His)
PV288281 500 ng

Olr1469 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
MPG sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1320005 3x 1.0 µg

MPG sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
ATP6AP1 (NM_001183) Human Tagged Lenti ORF Clone
RC200394L3 10 µg

ATP6AP1 (NM_001183) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details