Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EVI2A, Human (HEK293, Fc)

EVI2A may be a component of a cell surface receptor that forms a complex with itself or other proteins within the membrane, suggesting a role in mediating cellular responses through complex molecular interactions. Its ability to participate in self-complex formation or to interact with other proteins implies involvement in the organization of membrane-associated receptor structures. EVI2A Protein, Human (HEK293, Fc) is the recombinant human-derived EVI2A protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

EVI2A Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/evi2a-protein-human-hek293-fc.html

Purity

96.0

Smiles

NYTRLWANSTSSWDSVIQNKTGRNQNENINTNPITPEVDYKGNSTNMPETSHIVALTSKSEQELYIPSVVSNSPSTVQSIENTSKSHGEIFKKDVCAENNNNM

Molecular Formula

2123 (Gene_ID) P22794-1/NP_055025.2 (N31-M133) (Accession)

Molecular Weight

Approximately 70-80 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human MEP1A sgRNA gene knockout kit - Lentiviral human MEP1A sgRNA gene knockout kit (25)
GTR15377181 1 Vial

Lentiviral human MEP1A sgRNA gene knockout kit - Lentiviral human MEP1A sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
[ (E) -tetradec-11-enyl] acetate
JH260171 1 Each

[ (E) -tetradec-11-enyl] acetate

Sign In for Pricing
View Details
XAB2 Protein Vector (Mouse) (pPM-C-HA)
50494024 500 ng

XAB2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
T-cell Activation Antigen CD27 (CD27) Antibody (PE)
abx200209 100 Tests

T-cell Activation Antigen CD27 (CD27) Antibody (PE)

Sign In for Pricing
View Details
Lce1c sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3177605 3x 1.0 µg

Lce1c sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Lentiviral human NKAIN3 shRNA (UAS) - Lentiviral human NKAIN3 shRNA (UAS, iRFP) (25)
GTR15146954 1 Vial

Lentiviral human NKAIN3 shRNA (UAS) - Lentiviral human NKAIN3 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details