Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTRL-1, Human (HEK293, His)

CTRL-1 protein is an important member of the peptidase S1 family. As a serine protease, it catalyzes the hydrolysis of peptide bonds. CTRL-1 may share conserved features with related proteins that play important roles in cellular processes related to proteolysis and regulation of biological pathways. CTRL-1 Protein, Human (HEK293, His) is the recombinant human-derived CTRL-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CTRL-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctrl-1-protein-human-hek-293-his.html

Purity

95.0

Smiles

CGIPAIKPALSFSQRIVNGENAVLGSWPWQVSLQDSSGFHFCGGSLISQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYN

Molecular Formula

1506 (Gene_ID) P40313 (C19-N264) (Accession)

Molecular Weight

28-38 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PHOSPHO2 activation kit by CRISPRa
GA118583 1 Kit

Human PHOSPHO2 activation kit by CRISPRa

Sign In for Pricing
View Details
ATPAF2 Antibody
8C14600-AAT 50 µg

ATPAF2 Antibody

Sign In for Pricing
View Details
GPN1 / XAB1 (DNA Repair & Protein Synthesis) (GPN1/2350), CF488A conjugate, 0.1mg/mL
BNC882350-500 1x 500 µL

GPN1 / XAB1 (DNA Repair & Protein Synthesis) (GPN1/2350), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DISP2 Human Gene Knockout Kit (CRISPR)
KN423141 1 Kit

DISP2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Pit1 (POU1F1) (NM_000306) Human Over-expression Lysate
LY424805 100 µg

Pit1 (POU1F1) (NM_000306) Human Over-expression Lysate

Sign In for Pricing
View Details
Human CDC20B activation kit by CRISPRa
GA116152 1 Kit

Human CDC20B activation kit by CRISPRa

Sign In for Pricing
View Details