Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTRL-1, Human (HEK293, His)

CTRL-1 protein is an important member of the peptidase S1 family. As a serine protease, it catalyzes the hydrolysis of peptide bonds. CTRL-1 may share conserved features with related proteins that play important roles in cellular processes related to proteolysis and regulation of biological pathways. CTRL-1 Protein, Human (HEK293, His) is the recombinant human-derived CTRL-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CTRL-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctrl-1-protein-human-hek-293-his.html

Purity

95.0

Smiles

CGIPAIKPALSFSQRIVNGENAVLGSWPWQVSLQDSSGFHFCGGSLISQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYN

Molecular Formula

1506 (Gene_ID) P40313 (C19-N264) (Accession)

Molecular Weight

28-38 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM25 (NM_032780) Human Recombinant Protein
TP306385 20 µg

TMEM25 (NM_032780) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue Protein Lysate, Liver
CP565533 150 µg

Tissue Protein Lysate, Liver

Sign In for Pricing
View Details
2-(Diethylamino)ethanethiol Hydrochloride
TRC-D679955-1G 1 g

2-(Diethylamino)ethanethiol Hydrochloride

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA) / CD66 (C66/2055R), CF488A conjugate, 0.1mg/mL
BNC882055-100 1x 100 µL

Carcinoembryonic Antigen (CEA) / CD66 (C66/2055R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD127/IL-7RA Antibody[A019D5]
E-AB-F1152L-01 20 Tests

Elab Fluor® 488 Anti-Human CD127/IL-7RA Antibody[A019D5]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD127/IL-7RA Antibody[A019D5]
E-AB-F1152L-02 100 Tests

Elab Fluor® 488 Anti-Human CD127/IL-7RA Antibody[A019D5]

Sign In for Pricing
View Details