Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vascular endothelial growth factor A (VEGFA), partial

Product Specifications

Product Name Alternative

VEGF-A; Vascular permeability factor; VPF

Abbreviation

Recombinant Human VEGFA protein, partial

Gene Name

VEGFA

UniProt

P15692

Expression Region

39-143aa

Organism

Homo sapiens (Human)

Target Sequence

EVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKS

Tag

N-terminal 6xHis-mNeonGreen-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth. Binding to NRP1 receptor initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development. Also binds the DEAR/FBXW7-AS1 receptor.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

46.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial of Isoform 1

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXO30 Human shRNA Plasmid Kit (Locus ID 84085)
TL304557 1 Kit

FBXO30 Human shRNA Plasmid Kit (Locus ID 84085)

Sign In for Pricing
View Details
Gcm2 ORF Vector (Mouse) (pORF)
ORF045385 1.0 µg DNA

Gcm2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
FIS1 Recombinant Antibody, Cy5.5 Conjugated
bsm-61949R-Cy5.5 100 µL

FIS1 Recombinant Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal beta-13-Glucuronyltransferase 1/B3GAT1 Antibody (SPM129) - IHC-Prediluted
NBP2-48349 7 mL

Mouse Monoclonal beta-13-Glucuronyltransferase 1/B3GAT1 Antibody (SPM129) - IHC-Prediluted

Sign In for Pricing
View Details
Rabbit Polyclonal CABC1 Antibody
NBP2-15659 0.1 mL

Rabbit Polyclonal CABC1 Antibody

Sign In for Pricing
View Details
GAD1/GAD67 Rabbit pAb
MBS8575953-01 0.1 mL

GAD1/GAD67 Rabbit pAb

Sign In for Pricing
View Details