GIP, Mouse (HEK293, Fc)
GIP protein is a potent stimulator of insulin secretion that critically regulates glucose homeostasis by promoting insulin release from pancreatic beta cells. GIP has limited inhibitory effects on gastric acid secretion and plays dual roles in nutrient sensing and metabolic regulation, particularly in postprandial glucose metabolism. GIP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived GIP protein, expressed by HEK293 , with C-hFc labeled tag.
Product Specifications
Product Name Alternative
GIP Protein, Mouse (HEK293, Fc), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gip-protein-mouse-hek293-fc.html
Purity
95.0
Smiles
EKEEVEFRSHAKFAGPRPRGPRYAEGTFISDYSIAMDKIRQQDFVNWLLAQRGKKSDWKHNITQ
Molecular Formula
14607 (Gene_ID) P48756 (E22-Q85) (Accession)
Molecular Weight
Predicted MW is 34.3 kDa. Due to glycosylation, the protein migrates to 40-45 kDa based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF594 conjugate, 0.1mg/mL
CD44 Standard (DF1485), CF568 conjugate, 0.1mg/mL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/1887R), CF594 conjugate, 0.1mg/mL
GFAP (Astrocyte & Neural Stem Cell Marker) (ASTRO/1974R), CF568 conjugate, 0.1mg/mL
