Question 1

What is the catalog number for FASTKD5 Recombinant Protein Antigen?

Accepted Answer

The catalog number for FASTKD5 Recombinant Protein Antigen is NBP1-91888PEP.

Question 2

What sizes are available for FASTKD5 Recombinant Protein Antigen?

Accepted Answer

FASTKD5 Recombinant Protein Antigen is available in the following size(s): 0.1 mL.

Question 3

Is FASTKD5 Recombinant Protein Antigen in stock?

Accepted Answer

FASTKD5 Recombinant Protein Antigen is currently made to order / not held in immediate stock. Contact us for lead time.

Question 4

Can this product be used for diagnostic or therapeutic purposes?

Accepted Answer

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

Question 5

What is the shelf life of this product?

Accepted Answer

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

Question 6

What expression system was used for this recombinant protein?

Accepted Answer

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

FASTKD5 Recombinant Protein Antigen

Product Specifications

CAS Number

Frequently Asked Questions

Explore Other Products

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

CCT6B Polyclonal Antibody

CCT6B Polyclonal Antibody

CCT6B Polyclonal Antibody

CCT6B Polyclonal Antibody