Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF RII/TNFRSF1B, Human (HEK293, hFc)

TNFRII (TNFRSF1B) protein has a high ability to bind with tumor necrosis factor-alpha (TNF-α) . TNFRII has pro-apoptotic function. TNFRII recruits TRAF2, induces gene expression and intensively crosstalks with TNF-R1. TNFRII selectively enhances the induction of apoptosis by the death receptor TNFRI. TNFRII Protein, Human (HEK293, hFc) is expressed by HEK293 and has a transmembrane region (L23-D257) with hFc tag at the C-terminus[1].

Product Specifications

Product Name Alternative

TNF RII/TNFRSF1B Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnfrii-protein-human-hek-293-hfc.html

Purity

96.00

Smiles

LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD

Molecular Formula

7133 (Gene_ID) P20333-1 (L23-D257) (Accession)

Molecular Weight

Approximately 68 kDa

References & Citations

[1]Wajant H, et, al. Tumor necrosis factor signaling. Cell Death Differ. 2003 Jan;10 (1) :45-65.|[2]Fotin-Mleczek M, et, al. Apoptotic crosstalk of TNF receptors: TNF-R2-induces depletion of TRAF2 and IAP proteins and accelerates TNF-R1-dependent activation of caspase-8. J Cell Sci. 2002 Jul 1;115 (Pt 13) :2757-70.|[3]Masli S, et, al. Anti-inflammatory effects of tumour necrosis factor (TNF) -alpha are mediated via TNF-R2 (p75) in tolerogenic transforming growth factor-beta-treated antigen-presenting cells. Immunology. 2009 May;127 (1) :62-72.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal SNF5 Antibody (SMARCB1/4587R) [DyLight 405]
NBP3-14179V 0.1 mL

Rabbit Monoclonal SNF5 Antibody (SMARCB1/4587R) [DyLight 405]

Sign In for Pricing
View Details
Tecrl (NM_153801) Mouse Tagged Lenti ORF Clone
MR215827L4 10 µg

Tecrl (NM_153801) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Phospho-AKT1 (Thr34) Rabbit pAb, Pacific Blue conjugated
orb2824785 100 µL

Phospho-AKT1 (Thr34) Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
Mouse Monoclonal CD6 Antibody (3F7B5) [Janelia Fluor 646]
NBP2-34537JF646 0.1 mL

Mouse Monoclonal CD6 Antibody (3F7B5) [Janelia Fluor 646]

Sign In for Pricing
View Details
Native Trypsin (TRY)
SHPA217Po01-01 10 µg

Native Trypsin (TRY)

Sign In for Pricing
View Details
Native Trypsin (TRY)
SHPA217Po01-02 50 µg

Native Trypsin (TRY)

Sign In for Pricing
View Details