Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LUXS, E.coli (His)

LUXS proteins are critical for the synthesis of bacterially secreted autoinducer 2 (AI-2), which promotes communication between cell density and environmental metabolism. LUXS is critical for quorum sensing and catalyzes S-ribosylhomocysteine (RHC) to homocysteine (HC) and 4,5-dihydroxy-2,3-pentanedione (DPD), revealing its enzymatic role in AI-2 production. LUXS Protein, E.coli (His) is the recombinant E. coli-derived LUXS protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

LUXS Protein, E.coli (His), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/luxs-protein-e-coli.html

Purity

95.0

Smiles

PLLDSFTVDHTRMEAPAVRVAKTMNTPHGDAITVFDLRFCVPNKEVMPERGIHTLEHLFAGFMRNHLNGNGVEIIDISPMGCRTGFYMSLIGTPDEQRVADAWKAAMEDVLKVQDQNQIPELNVYQCGTYQMHSLQEAQDIARSILERDVRINSNEELALPKEKLQELHI

Molecular Formula

947168 (Gene_ID) P45578 (P2-I171) (Accession)

Molecular Weight

23-25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alectinib-d8
TRC-A521182-1MG 1 mg

Alectinib-d8

Sign In for Pricing
View Details
Human PITPNM2 activation kit by CRISPRa
GA111627 1 Kit

Human PITPNM2 activation kit by CRISPRa

Sign In for Pricing
View Details
DNA PKcs Recombinant Rabbit monoclonal Antibody
HA750198 100 µL

DNA PKcs Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Carbonic Anhydrase IX (CA9) (Renal Cell Carcinoma Marker) Mouse Monoclonal Antibody [Clone ID: SPM487]
AM33258PU-S 100 µg

Carbonic Anhydrase IX (CA9) (Renal Cell Carcinoma Marker) Mouse Monoclonal Antibody [Clone ID: SPM487]

Sign In for Pricing
View Details
PGAM2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B11]
TA503401AM 100 µL

PGAM2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B11]

Sign In for Pricing
View Details
NKX2.8 (NKX28/2548), CF405S conjugate, 0.1mg/mL
BNC042548-100 1x 100 µL

NKX2.8 (NKX28/2548), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details