Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LUXS, E.coli (His)

LUXS proteins are critical for the synthesis of bacterially secreted autoinducer 2 (AI-2), which promotes communication between cell density and environmental metabolism. LUXS is critical for quorum sensing and catalyzes S-ribosylhomocysteine (RHC) to homocysteine (HC) and 4,5-dihydroxy-2,3-pentanedione (DPD), revealing its enzymatic role in AI-2 production. LUXS Protein, E.coli (His) is the recombinant E. coli-derived LUXS protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

LUXS Protein, E.coli (His), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/luxs-protein-e-coli.html

Purity

95.0

Smiles

PLLDSFTVDHTRMEAPAVRVAKTMNTPHGDAITVFDLRFCVPNKEVMPERGIHTLEHLFAGFMRNHLNGNGVEIIDISPMGCRTGFYMSLIGTPDEQRVADAWKAAMEDVLKVQDQNQIPELNVYQCGTYQMHSLQEAQDIARSILERDVRINSNEELALPKEKLQELHI

Molecular Formula

947168 (Gene_ID) P45578 (P2-I171) (Accession)

Molecular Weight

23-25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAPT / TAU pSer262 Rabbit Polyclonal Antibody
AP02403PU-S 50 µL

MAPT / TAU pSer262 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Rat TNF-alpha/TNFA Protein
PKSR030457-01 10 µg

Recombinant Rat TNF-alpha/TNFA Protein

Sign In for Pricing
View Details
Recombinant Rat TNF-alpha/TNFA Protein
PKSR030457-02 50 µg

Recombinant Rat TNF-alpha/TNFA Protein

Sign In for Pricing
View Details
AMH Polyclonal Antibody
E-AB-15915-01 20 µL

AMH Polyclonal Antibody

Sign In for Pricing
View Details
AMH Polyclonal Antibody
E-AB-15915-02 60 µL

AMH Polyclonal Antibody

Sign In for Pricing
View Details
AMH Polyclonal Antibody
E-AB-15915-03 120 µL

AMH Polyclonal Antibody

Sign In for Pricing
View Details