Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LUXS, E.coli (His)

LUXS proteins are critical for the synthesis of bacterially secreted autoinducer 2 (AI-2), which promotes communication between cell density and environmental metabolism. LUXS is critical for quorum sensing and catalyzes S-ribosylhomocysteine (RHC) to homocysteine (HC) and 4,5-dihydroxy-2,3-pentanedione (DPD), revealing its enzymatic role in AI-2 production. LUXS Protein, E.coli (His) is the recombinant E. coli-derived LUXS protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

LUXS Protein, E.coli (His), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/luxs-protein-e-coli.html

Purity

95.0

Smiles

PLLDSFTVDHTRMEAPAVRVAKTMNTPHGDAITVFDLRFCVPNKEVMPERGIHTLEHLFAGFMRNHLNGNGVEIIDISPMGCRTGFYMSLIGTPDEQRVADAWKAAMEDVLKVQDQNQIPELNVYQCGTYQMHSLQEAQDIARSILERDVRINSNEELALPKEKLQELHI

Molecular Formula

947168 (Gene_ID) P45578 (P2-I171) (Accession)

Molecular Weight

23-25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CBX1 (NM_006807) Human Over-expression Lysate
LC402034 20 µg

CBX1 (NM_006807) Human Over-expression Lysate

Sign In for Pricing
View Details
Odad3 Mouse Gene Knockout Kit (CRISPR)
KN502669 1 Kit

Odad3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Teprenone
TRC-T103500-5G 5 g

Teprenone

Sign In for Pricing
View Details
MiTF (Microphthalmia Transcription Factor) (C5/D5), CF647 conjugate, 0.1mg/mL
BNC470892-500 1x 500 µL

MiTF (Microphthalmia Transcription Factor) (C5/D5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmf1 (NM_025928) Mouse Tagged ORF Clone
MG202074 10 µg

Pmf1 (NM_025928) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
KMT6/EZH2 Recombinant Rabbit Monoclonal Antibody [PSH04-14]
HA722095 100 µL

KMT6/EZH2 Recombinant Rabbit Monoclonal Antibody [PSH04-14]

Sign In for Pricing
View Details