Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LUXS, E.coli (His)

LUXS proteins are critical for the synthesis of bacterially secreted autoinducer 2 (AI-2), which promotes communication between cell density and environmental metabolism. LUXS is critical for quorum sensing and catalyzes S-ribosylhomocysteine (RHC) to homocysteine (HC) and 4,5-dihydroxy-2,3-pentanedione (DPD), revealing its enzymatic role in AI-2 production. LUXS Protein, E.coli (His) is the recombinant E. coli-derived LUXS protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

LUXS Protein, E.coli (His), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/luxs-protein-e-coli.html

Purity

95.0

Smiles

PLLDSFTVDHTRMEAPAVRVAKTMNTPHGDAITVFDLRFCVPNKEVMPERGIHTLEHLFAGFMRNHLNGNGVEIIDISPMGCRTGFYMSLIGTPDEQRVADAWKAAMEDVLKVQDQNQIPELNVYQCGTYQMHSLQEAQDIARSILERDVRINSNEELALPKEKLQELHI

Molecular Formula

947168 (Gene_ID) P45578 (P2-I171) (Accession)

Molecular Weight

23-25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRSN2 Polyclonal Antibody
E-AB-90839-01 60 µL

NRSN2 Polyclonal Antibody

Sign In for Pricing
View Details
NRSN2 Polyclonal Antibody
E-AB-90839-02 120 µL

NRSN2 Polyclonal Antibody

Sign In for Pricing
View Details
NRSN2 Polyclonal Antibody
E-AB-90839-03 200 µL

NRSN2 Polyclonal Antibody

Sign In for Pricing
View Details
Human CCDC83 activation kit by CRISPRa
GA116557 1 Kit

Human CCDC83 activation kit by CRISPRa

Sign In for Pricing
View Details
GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2391), CF640R conjugate, 0.1mg/mL
BNC402391-500 1x 500 µL

GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2391), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
D-Glucosamine-1,2-13C2 Hydrochloride
TRC-G514955-1MG 1 mg

D-Glucosamine-1,2-13C2 Hydrochloride

Sign In for Pricing
View Details