Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LUXS, E.coli (His)

LUXS proteins are critical for the synthesis of bacterially secreted autoinducer 2 (AI-2), which promotes communication between cell density and environmental metabolism. LUXS is critical for quorum sensing and catalyzes S-ribosylhomocysteine (RHC) to homocysteine (HC) and 4,5-dihydroxy-2,3-pentanedione (DPD), revealing its enzymatic role in AI-2 production. LUXS Protein, E.coli (His) is the recombinant E. coli-derived LUXS protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

LUXS Protein, E.coli (His), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/luxs-protein-e-coli.html

Purity

95.0

Smiles

PLLDSFTVDHTRMEAPAVRVAKTMNTPHGDAITVFDLRFCVPNKEVMPERGIHTLEHLFAGFMRNHLNGNGVEIIDISPMGCRTGFYMSLIGTPDEQRVADAWKAAMEDVLKVQDQNQIPELNVYQCGTYQMHSLQEAQDIARSILERDVRINSNEELALPKEKLQELHI

Molecular Formula

947168 (Gene_ID) P45578 (P2-I171) (Accession)

Molecular Weight

23-25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Marimastat 10mg
A12826-10 10 mg

Marimastat 10mg

Sign In for Pricing
View Details
ZNF195
CSB-CL026570HU 10 μg Plasmid + 200 μL Glycerol

ZNF195

Sign In for Pricing
View Details
M6A Polyclonal Antibody
MBS9245661-01 0.1 mL

M6A Polyclonal Antibody

Sign In for Pricing
View Details
M6A Polyclonal Antibody
MBS9245661-02 5x 0.1 mL

M6A Polyclonal Antibody

Sign In for Pricing
View Details
Ezh2 Mouse siRNA Oligo Duplex (Locus ID 14056)
SR419773 1 Kit

Ezh2 Mouse siRNA Oligo Duplex (Locus ID 14056)

Sign In for Pricing
View Details
Nkx6-3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6504707 1.0 µg DNA

Nkx6-3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details