Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MD-2/LY96, Human (142a.a, His)

MD2 protein binds bacterial lipopolysaccharide (LPS) and collaborates with TLR4 in the innate immune response to LPS. It also interacts with TLR2 in the response to cell wall components from bacteria. MD2 enhances TLR4-dependent NF-kappa-B activation and forms a heterogeneous homomer, participating in a multi-protein complex with CD14 and TLR4. Ligand binding induces complex oligomerization, crucial for the cellular response to LPS. MD-2/LY96 Protein, Human (142a.a, His) is the recombinant human-derived MD2 protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

MD-2/LY96 Protein, Human (142a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/md2-protein-human-his-solutin.html

Purity

95.0

Smiles

QKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKRSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN

Molecular Formula

23643 (Gene_ID) Q9Y6Y9-1 (Q19-N160) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1387), CF568 conjugate, 0.1mg/mL
BNC681387-500 1x 500 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1387), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF740 conjugate, 0.1mg/mL
BNC740040-500 1x 500 µL

CD35 / CR1 (E11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AKT1 (Prognostic Marker for Neuroendocrine Tumors) (AKT1/2552), CF405S conjugate, 0.1mg/mL
BNC042552-500 1x 500 µL

AKT1 (Prognostic Marker for Neuroendocrine Tumors) (AKT1/2552), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), 1mg/mL
BNUM0276-50 1x 50 µL

TAG-72 / CA72.4 (B72.3), 1mg/mL

Sign In for Pricing
View Details
Human Lambda Light Chain (LcN-2), CF568 conjugate, 0.1mg/mL
BNC680631-100 1x 100 µL

Human Lambda Light Chain (LcN-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FSH beta (FSHb/1062), CF405S conjugate, 0.1mg/mL
BNC041062-500 1x 500 µL

FSH beta (FSHb/1062), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details