Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HPGDS, Human

HPGDS protein is a multifunctional enzyme with bifunctionality, and its C-terminal and N-terminal domains have different activities.The C terminus acts as an epoxide hydrolase, promoting xenobiotic metabolism by degrading harmful epoxides and regulating physiological mediator levels.HPGDS Protein, Human is the recombinant human-derived HPGDS protein, expressed by E.coli , with tag free.

Product Specifications

Product Name Alternative

HPGDS Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hpgds-protein-human.html

Purity

95.00

Smiles

MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL

Molecular Formula

27306 (Gene_ID) O60760 (M1-L199) (Accession)

Molecular Weight

Approximately 26 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB11FIP4 Antibody : HRP (OAAF04112-HRP)
OAAF04112-100UG-HRP 100 µg

RAB11FIP4 Antibody : HRP (OAAF04112-HRP)

Sign In for Pricing
View Details
Ms4a10 Recombinant Rabbit monoclonal Antibody
HA750650 100 µL

Ms4a10 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
TEX11 Protein Lysate (Mouse) with C-HA Tag
46525035 100 µg

TEX11 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
EXTL1 Antibody
orb524147-01 50 μL

EXTL1 Antibody

Sign In for Pricing
View Details
EXTL1 Antibody
orb524147-02 100 µL

EXTL1 Antibody

Sign In for Pricing
View Details
TIGAR polyclonal antibody
orb1718852-01 50 µL

TIGAR polyclonal antibody

Sign In for Pricing
View Details