Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Dickkopf-related protein 4 (DKK4)

Product Specifications

Product Name Alternative

(Dickkopf-4) (Dkk-4) (hDkk-4)

Abbreviation

Recombinant Human DKK4 protein

Gene Name

DKK4

UniProt

Q9UBT3

Expression Region

19-224aa

Organism

Homo sapiens (Human)

Target Sequence

LVLDFNNIRSSADLHGARKGSQCLSDTDCNTRKFCLQPRDEKPFCATCRGLRRRCQRDAMCCPGTLCVNDVCTTMEDATPILERQLDEQDGTHAEGTTGHPVQENQPKRKPSIKKSQGRKGQEGESCLRTFDCGPGLCCARHFWTKICKPVLLEGQVCSRRGHKDTAQAPEIFQRCDCGPGLLCRSQLTSNRQHARLRVCQKIEKL

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

36 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B1), CF488A conjugate, 0.1mg/mL
BNC881930-500 1x 500 µL

PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, pan (Epithelial Marker) (KRTH/1576R + KRTL/1577R), CF740 conjugate, 0.1mg/mL
BNC741600-100 1x 100 µL

Cytokeratin, pan (Epithelial Marker) (KRTH/1576R + KRTL/1577R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant NDUFS6 Antibody
RC-5401-01 50 μL

Recombinant NDUFS6 Antibody

Sign In for Pricing
View Details
Recombinant NDUFS6 Antibody
RC-5401-02 100 µL

Recombinant NDUFS6 Antibody

Sign In for Pricing
View Details
Recombinant NDUFS6 Antibody
RC-5401-03 1 mL

Recombinant NDUFS6 Antibody

Sign In for Pricing
View Details
Thrombomodulin / CD141 (Endothelial Cell Marker) (THBD/1782), Biotin conjugate, 0.1mg/mL
BNCB1782-500 1x 500 µL

Thrombomodulin / CD141 (Endothelial Cell Marker) (THBD/1782), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details