Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-4, Mouse (CHO)

IL-4 Protein, Mouse (CHO) is a species-specific cytokine which promotes the proliferation, differentiation and cell-surface protein modulation of B lymphocytes.

Product Specifications

Product Name Alternative

IL-4 Protein, Mouse (CHO), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-4-protein-mouse-cho.html

Purity

96.00

Smiles

HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS

Molecular Formula

16189 (Gene_ID) P07750 (H21-S140) (Accession)

Molecular Weight

Approximately 15-22 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Levine AD, et al. High level expression and refolding of mouse interleukin 4 synthesized in Escherichia coli. J Biol Chem. 1995 Mar 31;270 (13) :7445-52.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Polq activation kit by CRISPRa
GA210822 1 Kit

Mouse Polq activation kit by CRISPRa

Ask
View Details
TOM1L1, CT (TOM1L1, SRCASM, TOM1-like protein 1, Src-activating and signaling molecule protein, Target of Myb-like protein 1) (MaxLight 750) discontinued
043119-ML750 100 µL

TOM1L1, CT (TOM1L1, SRCASM, TOM1-like protein 1, Src-activating and signaling molecule protein, Target of Myb-like protein 1) (MaxLight 750) discontinued

Ask
View Details
BAK, NT (BAK1, BCL2 Homologous Antagonist/Killer, CDN1, BCL2L7, Apoptosis Regulator BAK, Bcl-2-like Protein 7, Bcl2-L-7)
B0055-10K 250 µL

BAK, NT (BAK1, BCL2 Homologous Antagonist/Killer, CDN1, BCL2L7, Apoptosis Regulator BAK, Bcl-2-like Protein 7, Bcl2-L-7)

Ask
View Details
Human MEP1b (Meprin A Beta) ELISA Kit
ELK4277-01 48 Tests

Human MEP1b (Meprin A Beta) ELISA Kit

Ask
View Details
Human MEP1b (Meprin A Beta) ELISA Kit
ELK4277-02 96 Tests

Human MEP1b (Meprin A Beta) ELISA Kit

Ask
View Details
Human MEP1b (Meprin A Beta) ELISA Kit
ELK4277-03 5x 96 Tests

Human MEP1b (Meprin A Beta) ELISA Kit

Ask
View Details