Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-4, Mouse (CHO)

IL-4 Protein, Mouse (CHO) is a species-specific cytokine which promotes the proliferation, differentiation and cell-surface protein modulation of B lymphocytes.

Product Specifications

Product Name Alternative

IL-4 Protein, Mouse (CHO), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-4-protein-mouse-cho.html

Purity

96.00

Smiles

HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS

Molecular Formula

16189 (Gene_ID) P07750 (H21-S140) (Accession)

Molecular Weight

Approximately 15-22 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Levine AD, et al. High level expression and refolding of mouse interleukin 4 synthesized in Escherichia coli. J Biol Chem. 1995 Mar 31;270 (13) :7445-52.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRS2 (NM_003749) Human 3' UTR Clone
SC218912 10 µg

IRS2 (NM_003749) Human 3' UTR Clone

Sign In for Pricing
View Details
Twist1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV626637 1.0 µg DNA

Twist1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
TTC16 Antibody
orb1245035 100 µL

TTC16 Antibody

Sign In for Pricing
View Details
EVL Rabbit Polyclonal Antibody (Biotin)
orb2600120 100 µg

EVL Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Recombinant Human DARS2 Protein, N-His
YHK50301 100 μg

Recombinant Human DARS2 Protein, N-His

Sign In for Pricing
View Details
PAR6 alpha Antibody
46-130 0.1 mg

PAR6 alpha Antibody

Sign In for Pricing
View Details