Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Adiponectin/Acrp30, Human (CHO)

Adiponectin/Acrp30 Protein, Human (CHO) could increase cell sensitivity to insulin and can be used as a potential protein for treating diabetic tendinopathy

Product Specifications

Product Name Alternative

Adiponectin/Acrp30 Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/adiponectin-acrp30-protein-human-cho.html

Purity

95.00

Smiles

ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Molecular Formula

9370 (Gene_ID) Q15848 (E19-N244) (Accession)

Molecular Weight

25-28 kDa

References & Citations

[1]Kumada M, et al. Adiponectin specifically increased tissue inhibitor of metalloproteinase-1 through interleukin-10 expression in human macrophages. Circulation. 2004 May 4;109 (17) :2046-9.|[2]Rothan HA, et al. Recombinant human adiponectin as a potential protein for treating diabetic tendinopathy promotes tenocyte progenitor cells proliferation and tenogenic differentiation in vitro. Int J Med Sci. 2013 Nov 27;10 (13) :1899-906.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Drap1 (NM_024176) Mouse Tagged ORF Clone Lentiviral Particle
MR202156L4V 200 µL

Drap1 (NM_024176) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
Human Motility Related Protein ELISA Kit
MBS086036-01 48 Well

Human Motility Related Protein ELISA Kit

Ask
View Details
Human Motility Related Protein ELISA Kit
MBS086036-02 96 Well

Human Motility Related Protein ELISA Kit

Ask
View Details
Human Motility Related Protein ELISA Kit
MBS086036-03 5x 96 Well

Human Motility Related Protein ELISA Kit

Ask
View Details
Human Motility Related Protein ELISA Kit
MBS086036-04 10x 96 Well

Human Motility Related Protein ELISA Kit

Ask
View Details
Box of 50 Sterile Pp Syringe Filter 0.22µm, 25 Mm
SF25PP22SL Box of 50

Box of 50 Sterile Pp Syringe Filter 0.22µm, 25 Mm

Ask
View Details