Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Adiponectin/Acrp30, Human (CHO)

Adiponectin/Acrp30 Protein, Human (CHO) could increase cell sensitivity to insulin and can be used as a potential protein for treating diabetic tendinopathy

Product Specifications

Product Name Alternative

Adiponectin/Acrp30 Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/adiponectin-acrp30-protein-human-cho.html

Purity

95.00

Smiles

ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Molecular Formula

9370 (Gene_ID) Q15848 (E19-N244) (Accession)

Molecular Weight

25-28 kDa

References & Citations

[1]Kumada M, et al. Adiponectin specifically increased tissue inhibitor of metalloproteinase-1 through interleukin-10 expression in human macrophages. Circulation. 2004 May 4;109 (17) :2046-9.|[2]Rothan HA, et al. Recombinant human adiponectin as a potential protein for treating diabetic tendinopathy promotes tenocyte progenitor cells proliferation and tenogenic differentiation in vitro. Int J Med Sci. 2013 Nov 27;10 (13) :1899-906.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

DPF3, ID (DPF3, BAF45C, CERD4, Zinc finger protein DPF3, BRG1-associated factor 45C, Zinc finger protein cer-d4) (MaxLight 405) discontinued
034776-ML405 100 µL

DPF3, ID (DPF3, BAF45C, CERD4, Zinc finger protein DPF3, BRG1-associated factor 45C, Zinc finger protein cer-d4) (MaxLight 405) discontinued

Ask
View Details
Tupaia chinensis CD47/MER6 Protein (C-Fc, Tupaia chinensis (Chinese tree shrew) )
P509375 100 µg

Tupaia chinensis CD47/MER6 Protein (C-Fc, Tupaia chinensis (Chinese tree shrew) )

Ask
View Details
RILPL1 Rabbit Polyclonal Antibody
TA366615 100 µL

RILPL1 Rabbit Polyclonal Antibody

Ask
View Details
PLA2R (PLA2R1) (NM_007366) Human Recombinant Protein
TP790153 50 µg

PLA2R (PLA2R1) (NM_007366) Human Recombinant Protein

Ask
View Details
Trypsin (PRSS3) (NM_001197098) Human Tagged Lenti ORF Clone
RC231087L3 10 µg

Trypsin (PRSS3) (NM_001197098) Human Tagged Lenti ORF Clone

Ask
View Details