Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Adiponectin/Acrp30, Human (CHO)

Adiponectin/Acrp30 Protein, Human (CHO) could increase cell sensitivity to insulin and can be used as a potential protein for treating diabetic tendinopathy

Product Specifications

Product Name Alternative

Adiponectin/Acrp30 Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/adiponectin-acrp30-protein-human-cho.html

Purity

95.00

Smiles

ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Molecular Formula

9370 (Gene_ID) Q15848 (E19-N244) (Accession)

Molecular Weight

25-28 kDa

References & Citations

[1]Kumada M, et al. Adiponectin specifically increased tissue inhibitor of metalloproteinase-1 through interleukin-10 expression in human macrophages. Circulation. 2004 May 4;109 (17) :2046-9.|[2]Rothan HA, et al. Recombinant human adiponectin as a potential protein for treating diabetic tendinopathy promotes tenocyte progenitor cells proliferation and tenogenic differentiation in vitro. Int J Med Sci. 2013 Nov 27;10 (13) :1899-906.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Cat Endoplasmic Reticulum Aminopeptidase 1 (ERAP1) ELISA Kit
MBS9388841 Inquire

Cat Endoplasmic Reticulum Aminopeptidase 1 (ERAP1) ELISA Kit

Ask
View Details
MS4A2 (High Affinity Immunoglobulin epsilon Receptor Subunit beta, FcERI, Fc epsilon Receptor I beta-chain, IgE Fc Receptor Subunit beta, Membrane-spanning 4-domains Subfamily A Member 2, APY, FCER1B, IGER) (MaxLight 750)
MBS6233953-01 0.1 mL

MS4A2 (High Affinity Immunoglobulin epsilon Receptor Subunit beta, FcERI, Fc epsilon Receptor I beta-chain, IgE Fc Receptor Subunit beta, Membrane-spanning 4-domains Subfamily A Member 2, APY, FCER1B, IGER) (MaxLight 750)

Ask
View Details
MS4A2 (High Affinity Immunoglobulin epsilon Receptor Subunit beta, FcERI, Fc epsilon Receptor I beta-chain, IgE Fc Receptor Subunit beta, Membrane-spanning 4-domains Subfamily A Member 2, APY, FCER1B, IGER) (MaxLight 750)
MBS6233953-02 5x 0.1 mL

MS4A2 (High Affinity Immunoglobulin epsilon Receptor Subunit beta, FcERI, Fc epsilon Receptor I beta-chain, IgE Fc Receptor Subunit beta, Membrane-spanning 4-domains Subfamily A Member 2, APY, FCER1B, IGER) (MaxLight 750)

Ask
View Details
Recombinant Bacillus weihenstephanensis Tryptophan synthase alpha chain (trpA)
MBS1178225-01 0.02 mg (E-Coli)

Recombinant Bacillus weihenstephanensis Tryptophan synthase alpha chain (trpA)

Ask
View Details
Recombinant Bacillus weihenstephanensis Tryptophan synthase alpha chain (trpA)
MBS1178225-02 0.02 mg (Yeast)

Recombinant Bacillus weihenstephanensis Tryptophan synthase alpha chain (trpA)

Ask
View Details
Recombinant Bacillus weihenstephanensis Tryptophan synthase alpha chain (trpA)
MBS1178225-03 0.1 mg (E-Coli)

Recombinant Bacillus weihenstephanensis Tryptophan synthase alpha chain (trpA)

Ask
View Details