Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Adiponectin/Acrp30, Human (CHO)

Adiponectin/Acrp30 Protein, Human (CHO) could increase cell sensitivity to insulin and can be used as a potential protein for treating diabetic tendinopathy

Product Specifications

Product Name Alternative

Adiponectin/Acrp30 Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/adiponectin-acrp30-protein-human-cho.html

Purity

95.00

Smiles

ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Molecular Formula

9370 (Gene_ID) Q15848 (E19-N244) (Accession)

Molecular Weight

25-28 kDa

References & Citations

[1]Kumada M, et al. Adiponectin specifically increased tissue inhibitor of metalloproteinase-1 through interleukin-10 expression in human macrophages. Circulation. 2004 May 4;109 (17) :2046-9.|[2]Rothan HA, et al. Recombinant human adiponectin as a potential protein for treating diabetic tendinopathy promotes tenocyte progenitor cells proliferation and tenogenic differentiation in vitro. Int J Med Sci. 2013 Nov 27;10 (13) :1899-906.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Magic™ Membrane Protein Human TMEM35B (Transmembrane protein 35B) Expressed in vitro E.coli expression system, Full Length of Mature Protein
MPX1125K Each

Magic™ Membrane Protein Human TMEM35B (Transmembrane protein 35B) Expressed in vitro E.coli expression system, Full Length of Mature Protein

Ask
View Details
IgG1 Fc; IGHG1 Protein (Mouse)
P515887 100 µg

IgG1 Fc; IGHG1 Protein (Mouse)

Ask
View Details
Omega-amidase NIT2 (NIT2) Rat ELISA Kit
F5756 96 Tests

Omega-amidase NIT2 (NIT2) Rat ELISA Kit

Ask
View Details
SNORD115-21 CRISPR All-in-one AAV vector set (with saCas9)(Human)
44744151 3x 1.0 µg DNA

SNORD115-21 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Ask
View Details
Mouse Prostaglandin E1 (PGE1) ELISA Kit
EIA06211m 1 Kit

Mouse Prostaglandin E1 (PGE1) ELISA Kit

Ask
View Details