Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLGF, Rhesus macaque (HEK293, His)

PLGF protein is an important growth factor in angiogenesis and endothelial cell growth, stimulating cell proliferation and migration by binding to the FLT1/VEGFR-1 receptor. PLGF plays a crucial role in angiogenesis and also contributes to tumor growth, highlighting its involvement in pathological angiogenesis. PLGF Protein, Rhesus macaque (HEK293, His) is the recombinant Rhesus Macaque-derived PLGF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PLGF Protein, Rhesus macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/plgf-protein-rhesus-macaque-hek293-his.html

Purity

95.0

Smiles

LPAVPPQQWALSPGNGSSEVEVVPFQEVWGRSYCRALERLVDIVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETVNVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR

Molecular Formula

701219 (Gene_ID) F7HB10 (L19-R170) (Accession)

Molecular Weight

Approximately 28-34 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Advillin (AVIL) (NM_006576) Human Over-expression Lysate
LY416551 100 µg

Advillin (AVIL) (NM_006576) Human Over-expression Lysate

Sign In for Pricing
View Details
IKK alpha, phosphorylated (T23) (I kappa-B Kinase alpha, IkBKA, IKK-alpha, IKK-A, IkappaB Kinase, EC 2.7.11.10, I-kappa-B Kinase 1, IKK1, Conserved Helix-Loop-Helix ubiquitous Kinase, Nuclear Factor NF-kappa-B Inhibitor Kinase alpha, NFKBIKA, CHUK, IKKA, TCF16) discontinued
223519-01 50 µL

IKK alpha, phosphorylated (T23) (I kappa-B Kinase alpha, IkBKA, IKK-alpha, IKK-A, IkappaB Kinase, EC 2.7.11.10, I-kappa-B Kinase 1, IKK1, Conserved Helix-Loop-Helix ubiquitous Kinase, Nuclear Factor NF-kappa-B Inhibitor Kinase alpha, NFKBIKA, CHUK, IKKA, TCF16) discontinued

Sign In for Pricing
View Details
IKK alpha, phosphorylated (T23) (I kappa-B Kinase alpha, IkBKA, IKK-alpha, IKK-A, IkappaB Kinase, EC 2.7.11.10, I-kappa-B Kinase 1, IKK1, Conserved Helix-Loop-Helix ubiquitous Kinase, Nuclear Factor NF-kappa-B Inhibitor Kinase alpha, NFKBIKA, CHUK, IKKA, TCF16) discontinued
223519-02 100 µL

IKK alpha, phosphorylated (T23) (I kappa-B Kinase alpha, IkBKA, IKK-alpha, IKK-A, IkappaB Kinase, EC 2.7.11.10, I-kappa-B Kinase 1, IKK1, Conserved Helix-Loop-Helix ubiquitous Kinase, Nuclear Factor NF-kappa-B Inhibitor Kinase alpha, NFKBIKA, CHUK, IKKA, TCF16) discontinued

Sign In for Pricing
View Details
KCNK12 antibody
70R-5130 50 ug

KCNK12 antibody

Sign In for Pricing
View Details
TEAD3 Adenovirus (Human)
46467051 1.0 mL

TEAD3 Adenovirus (Human)

Sign In for Pricing
View Details
Recombinant Aeromonas Salmonicida yihI Protein (aa 1-193)
VAng-Lsx1147-1mgEcoli 1 mg (E. coli)

Recombinant Aeromonas Salmonicida yihI Protein (aa 1-193)

Sign In for Pricing
View Details