Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLGF, Rhesus macaque (HEK293, His)

PLGF protein is an important growth factor in angiogenesis and endothelial cell growth, stimulating cell proliferation and migration by binding to the FLT1/VEGFR-1 receptor. PLGF plays a crucial role in angiogenesis and also contributes to tumor growth, highlighting its involvement in pathological angiogenesis. PLGF Protein, Rhesus macaque (HEK293, His) is the recombinant Rhesus Macaque-derived PLGF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PLGF Protein, Rhesus macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/plgf-protein-rhesus-macaque-hek293-his.html

Purity

95.0

Smiles

LPAVPPQQWALSPGNGSSEVEVVPFQEVWGRSYCRALERLVDIVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETVNVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR

Molecular Formula

701219 (Gene_ID) F7HB10 (L19-R170) (Accession)

Molecular Weight

Approximately 28-34 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human POU4F3, His-tagged
POU4F3-1866H 25 µg

Recombinant Human POU4F3, His-tagged

Sign In for Pricing
View Details
(6S,10S) Lumateperone
TRC-L495910-25MG 25 mg

(6S,10S) Lumateperone

Sign In for Pricing
View Details
MtTMPK-IN-9
MBS5806325 Inquire

MtTMPK-IN-9

Sign In for Pricing
View Details
RPS6KC1 (NM_001287221) Human Tagged ORF Clone
RG239734 10 µg

RPS6KC1 (NM_001287221) Human Tagged ORF Clone

Sign In for Pricing
View Details
DCUN1D4 Knockout MES-OV Polyclonal Cells
ARG6600 1 Million

DCUN1D4 Knockout MES-OV Polyclonal Cells

Sign In for Pricing
View Details
KRT8P44 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV730599 1.0 µg DNA

KRT8P44 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details