Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLGF, Rhesus macaque (HEK293, His)

PLGF protein is an important growth factor in angiogenesis and endothelial cell growth, stimulating cell proliferation and migration by binding to the FLT1/VEGFR-1 receptor. PLGF plays a crucial role in angiogenesis and also contributes to tumor growth, highlighting its involvement in pathological angiogenesis. PLGF Protein, Rhesus macaque (HEK293, His) is the recombinant Rhesus Macaque-derived PLGF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PLGF Protein, Rhesus macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/plgf-protein-rhesus-macaque-hek293-his.html

Purity

95.0

Smiles

LPAVPPQQWALSPGNGSSEVEVVPFQEVWGRSYCRALERLVDIVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETVNVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR

Molecular Formula

701219 (Gene_ID) F7HB10 (L19-R170) (Accession)

Molecular Weight

Approximately 28-34 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSP50 (PRSS50) (NM_013270) Human Untagged Clone
SC125563 10 µg

TSP50 (PRSS50) (NM_013270) Human Untagged Clone

Sign In for Pricing
View Details
RPL35AP32-set siRNA/shRNA/RNAi Lentivector (Human)
41512091 4x 500 ng

RPL35AP32-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Recombinant Mycobacterium Bovis guaA Protein (aa 1-525)
VAng-Yyj3322-inquire Inquire

Recombinant Mycobacterium Bovis guaA Protein (aa 1-525)

Sign In for Pricing
View Details
CDX1 Mouse Monoclonal Antibody [Clone ID: OTI1C7]
TA810572 100 µL

CDX1 Mouse Monoclonal Antibody [Clone ID: OTI1C7]

Sign In for Pricing
View Details
NDUFB9 Mouse Monoclonal Antibody [Clone ID: OTI4F8]
TA502553 100 µL

NDUFB9 Mouse Monoclonal Antibody [Clone ID: OTI4F8]

Sign In for Pricing
View Details
Cxcl11 (NM_182952) Rat Untagged Clone
RN203718 10 µg

Cxcl11 (NM_182952) Rat Untagged Clone

Sign In for Pricing
View Details