Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLGF, Rhesus macaque (HEK293, His)

PLGF protein is an important growth factor in angiogenesis and endothelial cell growth, stimulating cell proliferation and migration by binding to the FLT1/VEGFR-1 receptor. PLGF plays a crucial role in angiogenesis and also contributes to tumor growth, highlighting its involvement in pathological angiogenesis. PLGF Protein, Rhesus macaque (HEK293, His) is the recombinant Rhesus Macaque-derived PLGF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PLGF Protein, Rhesus macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/plgf-protein-rhesus-macaque-hek293-his.html

Purity

95.0

Smiles

LPAVPPQQWALSPGNGSSEVEVVPFQEVWGRSYCRALERLVDIVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETVNVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR

Molecular Formula

701219 (Gene_ID) F7HB10 (L19-R170) (Accession)

Molecular Weight

Approximately 28-34 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LUF 6283
255712-01 10 mg

LUF 6283

Sign In for Pricing
View Details
LUF 6283
255712-02 50 mg

LUF 6283

Sign In for Pricing
View Details
ACY2 rabbit pAb
RA31007-01 50 µL

ACY2 rabbit pAb

Sign In for Pricing
View Details
ACY2 rabbit pAb
RA31007-02 100 µL

ACY2 rabbit pAb

Sign In for Pricing
View Details
Mouse TP73 (Tumor Protein p73) ELISA Kit
MBS7615540-01 48 Well

Mouse TP73 (Tumor Protein p73) ELISA Kit

Sign In for Pricing
View Details
Mouse TP73 (Tumor Protein p73) ELISA Kit
MBS7615540-02 96 Well

Mouse TP73 (Tumor Protein p73) ELISA Kit

Sign In for Pricing
View Details