Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLGF, Rhesus macaque (HEK293, His)

PLGF protein is an important growth factor in angiogenesis and endothelial cell growth, stimulating cell proliferation and migration by binding to the FLT1/VEGFR-1 receptor. PLGF plays a crucial role in angiogenesis and also contributes to tumor growth, highlighting its involvement in pathological angiogenesis. PLGF Protein, Rhesus macaque (HEK293, His) is the recombinant Rhesus Macaque-derived PLGF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PLGF Protein, Rhesus macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/plgf-protein-rhesus-macaque-hek293-his.html

Purity

95.0

Smiles

LPAVPPQQWALSPGNGSSEVEVVPFQEVWGRSYCRALERLVDIVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETVNVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR

Molecular Formula

701219 (Gene_ID) F7HB10 (L19-R170) (Accession)

Molecular Weight

Approximately 28-34 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal COP9 Antibody [Alexa Fluor 405]
NB100-365AF405 0.1 mL

Rabbit Polyclonal COP9 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
Phosphothreonine Proline (APC) discontinued
P4077-51-APC 100 µL

Phosphothreonine Proline (APC) discontinued

Sign In for Pricing
View Details
Ncstn (NM_174864) Rat Tagged ORF Clone Lentiviral Particle
RR205108L3V 200 µL

Ncstn (NM_174864) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
TGF beta1 BioAssayTM ELISA Kit
473776 96 Tests

TGF beta1 BioAssayTM ELISA Kit

Sign In for Pricing
View Details
HSPB1 Knockout 786-O Polyclonal Cells
ARG25298 1 Million

HSPB1 Knockout 786-O Polyclonal Cells

Sign In for Pricing
View Details
Rat Eda Pre-designed siRNA Set A
SI204205A 1 Each

Rat Eda Pre-designed siRNA Set A

Sign In for Pricing
View Details