Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLGF, Rhesus macaque (HEK293, His)

PLGF protein is an important growth factor in angiogenesis and endothelial cell growth, stimulating cell proliferation and migration by binding to the FLT1/VEGFR-1 receptor. PLGF plays a crucial role in angiogenesis and also contributes to tumor growth, highlighting its involvement in pathological angiogenesis. PLGF Protein, Rhesus macaque (HEK293, His) is the recombinant Rhesus Macaque-derived PLGF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PLGF Protein, Rhesus macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/plgf-protein-rhesus-macaque-hek293-his.html

Purity

95.0

Smiles

LPAVPPQQWALSPGNGSSEVEVVPFQEVWGRSYCRALERLVDIVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETVNVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR

Molecular Formula

701219 (Gene_ID) F7HB10 (L19-R170) (Accession)

Molecular Weight

Approximately 28-34 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CMPK1 (NM_016308) Human Recombinant Protein
TP304856M 100 µg

CMPK1 (NM_016308) Human Recombinant Protein

Sign In for Pricing
View Details
SOX10 Monoclonal Antibody
MBS668175-01 0.025 mg

SOX10 Monoclonal Antibody

Sign In for Pricing
View Details
SOX10 Monoclonal Antibody
MBS668175-02 0.1 mg

SOX10 Monoclonal Antibody

Sign In for Pricing
View Details
SOX10 Monoclonal Antibody
MBS668175-03 5x 0.1 mg

SOX10 Monoclonal Antibody

Sign In for Pricing
View Details
EIF2AK1, NT (Eukaryotic Translation Initiation Factor 2 alpha Kinase 1, Heme-regulated Eukaryotic Initiation Factor eIF-2-alpha Kinase, Heme-regulated Inhibitor, Heme-controlled Repressor, HCR, Hemin-sensitive Initiation Factor-2 alpha Kinase, PRO1362, HR
MBS6475184-01 0.1 mL

EIF2AK1, NT (Eukaryotic Translation Initiation Factor 2 alpha Kinase 1, Heme-regulated Eukaryotic Initiation Factor eIF-2-alpha Kinase, Heme-regulated Inhibitor, Heme-controlled Repressor, HCR, Hemin-sensitive Initiation Factor-2 alpha Kinase, PRO1362, HR

Sign In for Pricing
View Details
EIF2AK1, NT (Eukaryotic Translation Initiation Factor 2 alpha Kinase 1, Heme-regulated Eukaryotic Initiation Factor eIF-2-alpha Kinase, Heme-regulated Inhibitor, Heme-controlled Repressor, HCR, Hemin-sensitive Initiation Factor-2 alpha Kinase, PRO1362, HR
MBS6475184-02 5x 0.1 mL

EIF2AK1, NT (Eukaryotic Translation Initiation Factor 2 alpha Kinase 1, Heme-regulated Eukaryotic Initiation Factor eIF-2-alpha Kinase, Heme-regulated Inhibitor, Heme-controlled Repressor, HCR, Hemin-sensitive Initiation Factor-2 alpha Kinase, PRO1362, HR

Sign In for Pricing
View Details