Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLGF, Rhesus macaque (HEK293, His)

PLGF protein is an important growth factor in angiogenesis and endothelial cell growth, stimulating cell proliferation and migration by binding to the FLT1/VEGFR-1 receptor. PLGF plays a crucial role in angiogenesis and also contributes to tumor growth, highlighting its involvement in pathological angiogenesis. PLGF Protein, Rhesus macaque (HEK293, His) is the recombinant Rhesus Macaque-derived PLGF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PLGF Protein, Rhesus macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/plgf-protein-rhesus-macaque-hek293-his.html

Purity

95.0

Smiles

LPAVPPQQWALSPGNGSSEVEVVPFQEVWGRSYCRALERLVDIVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETVNVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR

Molecular Formula

701219 (Gene_ID) F7HB10 (L19-R170) (Accession)

Molecular Weight

Approximately 28-34 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CCDC105 siRNA
abx900827-01 15 nmol

Human CCDC105 siRNA

Sign In for Pricing
View Details
Human CCDC105 siRNA
abx900827-02 30 nmol

Human CCDC105 siRNA

Sign In for Pricing
View Details
Dars2 (NM_172644) Mouse Tagged ORF Clone Lentiviral Particle
MR209779L3V 200 µL

Dars2 (NM_172644) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
LAP2 (TMPO) (NM_001032283) Human 3' UTR Clone
SC212404 10 µg

LAP2 (TMPO) (NM_001032283) Human 3' UTR Clone

Sign In for Pricing
View Details
UltraPolymer Goat Anti-Rabbit/Mouse IgG (H&L) HRP Cocktail
A1280-15 15 mL

UltraPolymer Goat Anti-Rabbit/Mouse IgG (H&L) HRP Cocktail

Sign In for Pricing
View Details
Igsf9 (NM_001145800) Mouse Tagged ORF Clone
MR211762 10 µg

Igsf9 (NM_001145800) Mouse Tagged ORF Clone

Sign In for Pricing
View Details