Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLGF, Rhesus macaque (HEK293, His)

PLGF protein is an important growth factor in angiogenesis and endothelial cell growth, stimulating cell proliferation and migration by binding to the FLT1/VEGFR-1 receptor. PLGF plays a crucial role in angiogenesis and also contributes to tumor growth, highlighting its involvement in pathological angiogenesis. PLGF Protein, Rhesus macaque (HEK293, His) is the recombinant Rhesus Macaque-derived PLGF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PLGF Protein, Rhesus macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/plgf-protein-rhesus-macaque-hek293-his.html

Purity

95.0

Smiles

LPAVPPQQWALSPGNGSSEVEVVPFQEVWGRSYCRALERLVDIVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETVNVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR

Molecular Formula

701219 (Gene_ID) F7HB10 (L19-R170) (Accession)

Molecular Weight

Approximately 28-34 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF837 (NM_138466) Human 3' UTR Clone
SC201086 10 µg

ZNF837 (NM_138466) Human 3' UTR Clone

Sign In for Pricing
View Details
Fem1c Rat shRNA Plasmid (Locus ID 302288)
TL705505 1 Kit

Fem1c Rat shRNA Plasmid (Locus ID 302288)

Sign In for Pricing
View Details
Dscc1 sgRNA CRISPR Lentivector set (Mouse)
K4334301 3x 1.0 µg

Dscc1 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
ACVR2A Protein Vector (Human) (pPM-C-HA)
PV000615 500 ng

ACVR2A Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
TAF7 (TAF7 RNA Polymerase II, TATA Box Binding Protein (TBP) -Associated Factor, 55kD, TAF2F, TAFII55) (HRP)
252358-HRP 100 µL

TAF7 (TAF7 RNA Polymerase II, TATA Box Binding Protein (TBP) -Associated Factor, 55kD, TAF2F, TAFII55) (HRP)

Sign In for Pricing
View Details
Mouse Monoclonal Chromogranin C Antibody (SGII 6B1/3) [DyLight 594]
NBP2-76658DL594 0.1 mL

Mouse Monoclonal Chromogranin C Antibody (SGII 6B1/3) [DyLight 594]

Sign In for Pricing
View Details