Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLGF, Rhesus macaque (HEK293, His)

PLGF protein is an important growth factor in angiogenesis and endothelial cell growth, stimulating cell proliferation and migration by binding to the FLT1/VEGFR-1 receptor. PLGF plays a crucial role in angiogenesis and also contributes to tumor growth, highlighting its involvement in pathological angiogenesis. PLGF Protein, Rhesus macaque (HEK293, His) is the recombinant Rhesus Macaque-derived PLGF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PLGF Protein, Rhesus macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/plgf-protein-rhesus-macaque-hek293-his.html

Purity

95.0

Smiles

LPAVPPQQWALSPGNGSSEVEVVPFQEVWGRSYCRALERLVDIVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETVNVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR

Molecular Formula

701219 (Gene_ID) F7HB10 (L19-R170) (Accession)

Molecular Weight

Approximately 28-34 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NANP Mouse Monoclonal Antibody [Clone ID: LBI2D11]
AMM12548V 100 µL

NANP Mouse Monoclonal Antibody [Clone ID: LBI2D11]

Sign In for Pricing
View Details
ASFV B117L Polyclonal Antibody
E55A04090 100 µg

ASFV B117L Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal AMD1 Antibody [Alexa Fluor 488]
NBP2-97180AF488 0.1 mL

Rabbit Polyclonal AMD1 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
S100g (NM_009789) Mouse Tagged ORF Clone Lentiviral Particle
MR221102L4V 200 µL

S100g (NM_009789) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
RTDR1 Adenovirus (Rat)
42859056 1.0 mL

RTDR1 Adenovirus (Rat)

Sign In for Pricing
View Details
Anti-Human DLL4 Antibody (SAA0165), FITC
MBS1585148-01 50 Tests

Anti-Human DLL4 Antibody (SAA0165), FITC

Sign In for Pricing
View Details