Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLGF, Rhesus macaque (HEK293, His)

PLGF protein is an important growth factor in angiogenesis and endothelial cell growth, stimulating cell proliferation and migration by binding to the FLT1/VEGFR-1 receptor. PLGF plays a crucial role in angiogenesis and also contributes to tumor growth, highlighting its involvement in pathological angiogenesis. PLGF Protein, Rhesus macaque (HEK293, His) is the recombinant Rhesus Macaque-derived PLGF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PLGF Protein, Rhesus macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/plgf-protein-rhesus-macaque-hek293-his.html

Purity

95.0

Smiles

LPAVPPQQWALSPGNGSSEVEVVPFQEVWGRSYCRALERLVDIVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETVNVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR

Molecular Formula

701219 (Gene_ID) F7HB10 (L19-R170) (Accession)

Molecular Weight

Approximately 28-34 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LGR5 Mouse Monoclonal Antibody [Clone ID: OTI11C2]
TA808304 100 µL

LGR5 Mouse Monoclonal Antibody [Clone ID: OTI11C2]

Sign In for Pricing
View Details
VAT1 (NM_006373) Human Untagged Clone
SC322371 10 µg

VAT1 (NM_006373) Human Untagged Clone

Sign In for Pricing
View Details
OR4F15, NT (OR4F15, Olfactory receptor 4F15, Olfactory receptor OR15-14)
039392 200 µL

OR4F15, NT (OR4F15, Olfactory receptor 4F15, Olfactory receptor OR15-14)

Sign In for Pricing
View Details
Lentiviral mouse Areg shRNA (UAS) - Lentiviral mouse Areg shRNA (UAS, iRFP) plasmid
GTR15220972 1 Vial

Lentiviral mouse Areg shRNA (UAS) - Lentiviral mouse Areg shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Anti-IGF1 (Ganitumab)-MC-Vc-PAB-MMAE ADC
ADC-W-1241 1 mg

Anti-IGF1 (Ganitumab)-MC-Vc-PAB-MMAE ADC

Sign In for Pricing
View Details
Rat Monoclonal IL-20 R beta/FNDC6 Antibody (20RNTC) [Allophycocyanin/Cy7]
NBP2-00466APCCY7 0.1 mL

Rat Monoclonal IL-20 R beta/FNDC6 Antibody (20RNTC) [Allophycocyanin/Cy7]

Sign In for Pricing
View Details