Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLGF, Rhesus macaque (HEK293, His)

PLGF protein is an important growth factor in angiogenesis and endothelial cell growth, stimulating cell proliferation and migration by binding to the FLT1/VEGFR-1 receptor. PLGF plays a crucial role in angiogenesis and also contributes to tumor growth, highlighting its involvement in pathological angiogenesis. PLGF Protein, Rhesus macaque (HEK293, His) is the recombinant Rhesus Macaque-derived PLGF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PLGF Protein, Rhesus macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/plgf-protein-rhesus-macaque-hek293-his.html

Purity

95.0

Smiles

LPAVPPQQWALSPGNGSSEVEVVPFQEVWGRSYCRALERLVDIVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETVNVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR

Molecular Formula

701219 (Gene_ID) F7HB10 (L19-R170) (Accession)

Molecular Weight

Approximately 28-34 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1306000 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6027706 1.0 µg DNA

RGD1306000 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
RGD1562433 3'UTR GFP Stable Cell Line
TU268580 1.0 mL

RGD1562433 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
HRP-conjugated His-Tag Monoclonal Antibody
MBS2578954-01 0.025 mL

HRP-conjugated His-Tag Monoclonal Antibody

Sign In for Pricing
View Details
HRP-conjugated His-Tag Monoclonal Antibody
MBS2578954-02 0.1 mL

HRP-conjugated His-Tag Monoclonal Antibody

Sign In for Pricing
View Details
HRP-conjugated His-Tag Monoclonal Antibody
MBS2578954-03 5x 0.1 mL

HRP-conjugated His-Tag Monoclonal Antibody

Sign In for Pricing
View Details
LOC100359973 3'UTR GFP Stable Cell Line
TU257391 1.0 mL

LOC100359973 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details