Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLGF, Rhesus macaque (HEK293, His)

PLGF protein is an important growth factor in angiogenesis and endothelial cell growth, stimulating cell proliferation and migration by binding to the FLT1/VEGFR-1 receptor. PLGF plays a crucial role in angiogenesis and also contributes to tumor growth, highlighting its involvement in pathological angiogenesis. PLGF Protein, Rhesus macaque (HEK293, His) is the recombinant Rhesus Macaque-derived PLGF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PLGF Protein, Rhesus macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/plgf-protein-rhesus-macaque-hek293-his.html

Purity

95.0

Smiles

LPAVPPQQWALSPGNGSSEVEVVPFQEVWGRSYCRALERLVDIVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETVNVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR

Molecular Formula

701219 (Gene_ID) F7HB10 (L19-R170) (Accession)

Molecular Weight

Approximately 28-34 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PerCP/Fire™ 806 anti-human CD123
GT16622 25 Tests

PerCP/Fire™ 806 anti-human CD123

Sign In for Pricing
View Details
1- (4-chlorobutyl) pyrrolidine-2,5-dione
JH663036 1 Each

1- (4-chlorobutyl) pyrrolidine-2,5-dione

Sign In for Pricing
View Details
SUMO-1 Mouse Monoclonal Antibody
MBS438020-01 0.02 mg (With BSA & Azide at 0.2mg/mL)

SUMO-1 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
SUMO-1 Mouse Monoclonal Antibody
MBS438020-02 0.1 mg (With BSA & Azide at 0.2mg/mL)

SUMO-1 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
SUMO-1 Mouse Monoclonal Antibody
MBS438020-03 0.1 mg (Without BSA & Azide at 1mg/mL)

SUMO-1 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
SUMO-1 Mouse Monoclonal Antibody
MBS438020-04 5x 0.1 mg (With BSA & Azide at 0.2mg/mL)

SUMO-1 Mouse Monoclonal Antibody

Sign In for Pricing
View Details