Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NIP7, Human (His)

NIP7 is essential for precise processing of 34S pre-rRNA and assembly of 60S ribosomal subunits. As a monomer, NIP7 interacts with preribosomal complexes, may bind to RNA, and binds to key protein partners, including NOL8, SBDS, and FTSJ3. NIP7 Protein, Human (His) is the recombinant human-derived NIP7 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

NIP7 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nip7-protein-human-his.html

Smiles

MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT

Molecular Formula

51388 (Gene_ID) Q9Y221-1 (M1-T180) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Ubiquitin-Conjugating Enzyme E2I, His Tag (Recombinant)
22060507-1 10 μg

Human Ubiquitin-Conjugating Enzyme E2I, His Tag (Recombinant)

Ask
View Details
Asz1 (NM_023729) Mouse Tagged Lenti ORF Clone
MR207612L4 10 µg

Asz1 (NM_023729) Mouse Tagged Lenti ORF Clone

Ask
View Details
Osteogenic Growth Peptide (OGP) BioAssayTM ELISA Kit (Human) discontinued
152910-01 48 Tests

Osteogenic Growth Peptide (OGP) BioAssayTM ELISA Kit (Human) discontinued

Ask
View Details
Osteogenic Growth Peptide (OGP) BioAssayTM ELISA Kit (Human) discontinued
152910-02 96 Tests

Osteogenic Growth Peptide (OGP) BioAssayTM ELISA Kit (Human) discontinued

Ask
View Details
HUR Mouse Monoclonal Antibody
E38QA9406 100 µL

HUR Mouse Monoclonal Antibody

Ask
View Details
ETFb (Electron Transfer Flavoprotein β Polypeptide) Porcine ELISA Kit
D2631 96 Tests

ETFb (Electron Transfer Flavoprotein β Polypeptide) Porcine ELISA Kit

Ask
View Details