Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NIP7, Human (His)

NIP7 is essential for precise processing of 34S pre-rRNA and assembly of 60S ribosomal subunits. As a monomer, NIP7 interacts with preribosomal complexes, may bind to RNA, and binds to key protein partners, including NOL8, SBDS, and FTSJ3. NIP7 Protein, Human (His) is the recombinant human-derived NIP7 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

NIP7 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nip7-protein-human-his.html

Smiles

MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT

Molecular Formula

51388 (Gene_ID) Q9Y221-1 (M1-T180) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit anti-MPP8 Antibody, Affinity Purified
A303-051A-T 10 µg

Rabbit anti-MPP8 Antibody, Affinity Purified

Ask
View Details
PAK5 (p21 Activated Kinase 5, p21-activated Kinase 5, PAK5, PAK-5, KIAA1264, MGC26232, p21 (CDKN1A) -activated Kinase 7, p21-activated Kinase 7, PAK7, PAK-7, Protein Kinase PAK5, Serine/threonine-protein Kinase PAK 7)
146004 100 µg

PAK5 (p21 Activated Kinase 5, p21-activated Kinase 5, PAK5, PAK-5, KIAA1264, MGC26232, p21 (CDKN1A) -activated Kinase 7, p21-activated Kinase 7, PAK7, PAK-7, Protein Kinase PAK5, Serine/threonine-protein Kinase PAK 7)

Ask
View Details
Gastrin 17 (G17) Rapid Test Kit
RNS92225-01 1 Test

Gastrin 17 (G17) Rapid Test Kit

Ask
View Details
Gastrin 17 (G17) Rapid Test Kit
RNS92225-02 20 Tests

Gastrin 17 (G17) Rapid Test Kit

Ask
View Details
Olfactory receptor 8H3 Polyclonal Antibody
MBS8524427-01 0.1 mg

Olfactory receptor 8H3 Polyclonal Antibody

Ask
View Details
Olfactory receptor 8H3 Polyclonal Antibody
MBS8524427-02 0.1 mL (AF635)

Olfactory receptor 8H3 Polyclonal Antibody

Ask
View Details