Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIAA0101, Human (His)

The KIAA0101 protein is a PCNA-binding regulator that plays a key role in DNA repair during replication. After DNA damage, it disrupts its interaction with PCNA and promotes the binding between monoubiquitinated PCNA and DNA polymerase eta (POLH) . KIAA0101 Protein, Human (His) is the recombinant human-derived KIAA0101 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

KIAA0101 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kiaa0101-protein-human-his.html

Purity

98.0

Smiles

MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE

Molecular Formula

9768 (Gene_ID) Q15004-1 (M1-E111) (Accession)

Molecular Weight

Approximately 17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Colon
CS708768 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
Recombinant Human Leptin Protein
PKSH032688-01 10 µg

Recombinant Human Leptin Protein

Sign In for Pricing
View Details
Recombinant Human Leptin Protein
PKSH032688-02 50 µg

Recombinant Human Leptin Protein

Sign In for Pricing
View Details
(R)-(+)-[1,1'-Binaphthalene]-2,2'-diamine
TRC-B387010-5G 5 g

(R)-(+)-[1,1'-Binaphthalene]-2,2'-diamine

Sign In for Pricing
View Details
Xanthorrhizol (Technical grade)
TRC-X742075-5MG 5 mg

Xanthorrhizol (Technical grade)

Sign In for Pricing
View Details
IL20 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C2]
TA803298BM 100 µL

IL20 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C2]

Sign In for Pricing
View Details